KEGG   Helianthus annuus (common sunflower): 110879887Help
Entry
110879887         CDS       T05101                                 

Definition
(RefSeq) cyclin-dependent kinase G-2-like
  KO
K08818  cell division cycle 2-like [EC:2.7.11.22]
Organism
han  Helianthus annuus (common sunflower)
Brite
KEGG Orthology (KO) [BR:han00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:han01001]
    110879887
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:han03041]
    110879887
Enzymes [BR:han01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     110879887
Protein kinases [BR:han01001]
 Serine/threonine kinases: CMGC group
  CDK family
   110879887
Spliceosome [BR:han03041]
 Complex A
  Other components
   Complex A specific factors
    110879887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Kdo APH
Motif
Other DBs
NCBI-GeneID: 110879887
NCBI-ProteinID: XP_021984110
AA seq 515 aa AA seqDB search
MAAGRHNFLSKRQEAVSYRSRSSTQFTKVSDERNGFIDGSTRKRKVSPIVWDRFDEKQVK
ICSKNRVYSTSSVVSRFSSPEIGSVAGKTECRISSVESVVSNVSDDVESPRLLAANSPED
GEYVVAPNLSKSKWAFEDSPRLESDVTYSSPESGEFKQDEVFLSDEDTNNVDEKVAGASS
GYLSSESDDENETSLSTGSGIWPSCRHVTEYERLGKINEGTYGVVHKARDKKTGEVVALK
KVKLGSDREGFPVTALREINILGMLQHPSLVEMKEVVTDDFDGVYMVMECVDHELKGYME
RMKQPFSQGEVKRLMIQLLEGVAYLHDNYVMHRDLKTSNLLLNNDGELKICDFGMSRHYA
SPLKPYTSLVVTLWYRAPELLLGMKNYSTAIDMWSVGCIMAELLSGKPLFDGNKEVEQID
KIFRTLGTPNESIWSGYSKLPGVKPNFVKQPYSLLRKKFPVAVFTGSPMLTELGFDLLNK
FLTYDPEKRITAREALDHGWFREAPLPAEHVRICR
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaggacgacacaacttcttgagcaaaagacaagaagctgtttcttatagatcc
agatccagcactcaatttactaaagtttcagatgaaagaaacgggttcattgatggatct
acgaggaagagaaaggtttcaccgattgtgtgggacagatttgatgagaagcaagtgaag
atttgttctaagaacagagtttattccactagctctgttgttagtcggttttcgtcgcct
gaaatcggttcggttgctggtaaaactgagtgtcgaatttcttctgttgagtctgttgtt
tctaatgtttcagatgatgtggaatcaccaaggttgttggctgcaaattctcccgaagat
ggagagtatgttgtggctccgaacttatcgaaatcgaagtgggcgtttgaagactcgcca
agactcgaatctgatgttacttattcaagcccggagagtggtgaattcaagcaagatgag
gtgtttttgtcagatgaagataccaacaatgttgatgaaaaggttgccggtgctagctcg
ggttacttaagctccgaaagtgatgacgagaatgaaacttcgttatccaccggatcaggc
atatggccgagttgtagacatgtgactgaatacgagagattgggtaagattaatgaaggc
acttacggtgtcgttcacaaagctagggataagaaaaccggagaagttgtggcgttgaag
aaggtgaagttggggagtgacagagaaggtttcccggtgacagctttaagggagattaac
attctcggtatgttacaacacccgtctctcgtagaaatgaaggaagttgttactgacgat
ttcgatggtgtttatatggttatggagtgtgttgatcatgaacttaaagggtatatggaa
cgaatgaagcagccgtttagtcaaggcgaggtgaaacgccttatgatacagcttctggag
ggtgtggcttatcttcatgataactacgtgatgcatagggatttgaagacctcaaacttg
ctgttgaacaacgatggtgagttgaagatttgtgacttcgggatgtctcggcattatgcg
agtccgcttaaaccgtatacttctttggtggtcacactttggtacagggcgcctgagctt
cttttggggatgaaaaattattcaactgctattgacatgtggtcggtgggttgtataatg
gcggagttgctgtctggtaaaccgctttttgatggcaacaaggaagttgagcagattgac
aagattttcagaacgcttggaacaccgaatgagtctatatggtctgggtactcgaagctt
ccaggtgtcaaacccaactttgtcaaacaaccgtatagtcttttgaggaagaagtttcct
gtggctgtttttacaggctcacctatgcttaccgagttgggatttgatttgttgaacaag
tttctaacgtatgatccggagaagaggataaccgcgagagaagctcttgatcatggatgg
tttcgtgaggctcctcttcctgctgaacatgttaggatttgtagatag

DBGET integrated database retrieval system