KEGG   Helianthus annuus (common sunflower): 110879958Help
Entry
110879958         CDS       T05101                                 

Definition
(RefSeq) probable serine/threonine-protein kinase At1g54610
  KO
K08819  cyclin-dependent kinase 12/13 [EC:2.7.11.22 2.7.11.23]
Organism
han  Helianthus annuus (common sunflower)
Brite
KEGG Orthology (KO) [BR:han00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:han01001]
    110879958
Enzymes [BR:han01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     110879958
    2.7.11.23  [RNA-polymerase]-subunit kinase
     110879958
Protein kinases [BR:han01001]
 Serine/threonine kinases: CMGC group
  CDK family
   110879958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Haspin_kinase Seadorna_VP7 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 110879958
NCBI-ProteinID: XP_021984200
AA seq 567 aa AA seqDB search
MGCVLGASDRRSNSNVRHRSAEESTTASHTQPDAPSDNVEKRIRQISGDVRPSNRGKLKL
EYSLHTAPSWPEWLSAVAGDAIQDWTPRRANTFEKLDKIGQGTYSNVYKARDLITGKIVA
LKKVRVDTLEPENVKFMAREILILKKLNHPNIIKLEGLVTSRMSSSLYLVFEYMEHDLSG
LAAVQGLKFTEPQIKCFIKQLLSGLEHCHKNGVLHRDIKGSNLLIDDDGVLKIADFGLAS
FYDPQNKQPMTSRVVTLWYRPPELLLGATNYGVGVDMWSAGCILAELLAGKPIMPGRTEV
EQLHKIFKLCGSPSEEYWKRHRLPNATLFKPRQPYKRCTAEVFKEFPSSSLPLLESLLAI
DPDERSSAVASLNSDFFTTEPYACEPSELPKYPPSKELDVKLRDEEARRRRGLTGKSHAV
DGNKKPRTRDRVGQAVPAPEANAEIQSNLDRWRVINQSNAKSKSEKFPPPHRDAAVGHPL
DPSHNGGQVSFGAGDDISFSSSVVDAKASKSVGEVGSIGGPSKRNHKRERSQTASTRKFI
RAFFPTSISLNMDLRFKSKEAVLRNRR
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgtgctcggagcttcagatcgccggtcaaactcaaacgtccgccaccggagt
gccgaagaatccaccaccgcttctcatacgcaaccggatgctccgtcggataacgttgag
aagaggatcagacaaatctccggcgatgttcgtccgtctaaccgcgggaaactgaagctc
gagtatagcctccacaccgctccgtcgtggccggagtggctctccgccgtcgccggtgac
gccattcaggattggactcctcgtcgtgctaataccttcgagaaactcgataagataggg
caagggacgtatagcaatgtgtataaggctagggatttgataactggtaaaatagttgct
ttgaagaaagttagggttgatacattagagcctgagaatgttaagtttatggcgagagag
attttgatactgaagaagcttaatcatccgaatattataaagcttgaaggattggttaca
tctagaatgtcttccagtctttaccttgtgtttgaatacatggagcatgatctttctggt
cttgctgctgttcaaggtctcaaattcacagagcctcagatcaagtgtttcatcaaacag
ttactttctgggcttgaacattgccataagaacggtgtgttacaccgagatatcaaggga
tctaatttgctgattgacgatgatggtgttcttaaaatagcggattttggattagcgtct
ttttatgatccgcaaaacaagcagcccatgactagccgtgttgttactctctggtaccga
ccccccgagctgcttctcggggccacaaattatggtgttggagttgatatgtggagtgct
ggttgcattttggctgaactccttgctggcaaaccaataatgccgggtcgcacagaggtt
gaacagttacacaagatatttaaattatgtggctcaccatcagaggaatattggaagagg
catcgtttgccaaatgcgactttatttaagccacgtcagccatacaagcgttgtacagca
gaagtgtttaaagagtttccatcttcttctcttcctttattagagagtcttcttgcaatt
gatcctgatgagcgcagctctgctgttgcatcccttaacagtgatttcttcaccactgaa
ccttatgcttgtgagccctcagaattaccaaaataccctcccagcaaagaactagatgtc
aaattgagggatgaagaagccagaagacgaagaggtttgaccggaaaatctcatgccgtt
gacggaaataaaaaaccaagaacccgtgatcgtgtgggtcaggcagttccagccccagag
gcgaatgcagagatccaatccaacttagacagatggagagttataaatcaatcgaacgcg
aaaagcaagagcgagaaattccctcctcctcatcgggatgcagctgtggggcatccgctt
gatccgtcacataatggcgggcaggtttctttcggtgcgggtgatgacatatcgtttagc
tcatctgtggttgatgcaaaagcttcaaaatcagtcggtgaagttgggagcattggtggc
ccgtctaagaggaatcataaaagggaacgatcacaaacggcgtcaactcgtaagttcata
cgggccttttttccgacttccattagtctaaatatggatttgagattcaaaagtaaagaa
gcggttttgcgcaatcgaaggtag

DBGET integrated database retrieval system