KEGG   Helianthus annuus (common sunflower): 110879961Help
Entry
110879961         CDS       T05101                                 

Definition
(RefSeq) probable protein S-acyltransferase 7
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
han  Helianthus annuus (common sunflower)
Brite
Enzymes [BR:han01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     110879961
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC DUF1218
Motif
Other DBs
NCBI-GeneID: 110879961
NCBI-ProteinID: XP_021984206
AA seq 422 aa AA seqDB search
MYGVHPPKNSDAAVAGDTADVIRTYQAWEGSNVFFLGGRFIFGPDIQSIFLSISLIVVPV
VIFCVFVGRKLLDDFNHHLGILVMVIAIVLSVYVLTMLLVTSGRDPGIVPRNKRPPEPEV
VLDQSLDVGPGQTPQLRPPRFKEVTVNGLTVKVKYCDTCMLYRPPRCSHCSICDNCVDRF
DHHCPWVGQCIGLRNYRFYFMFVSSATLLCIYIFAFCWVYAIKIKNSEDTSIWGALIKTP
ASIVLIIYTFICVWFVGGLTVFHLYLISTNQSTYENFRYRYDRTENPYNRGIIENFKEVF
WRSIPPSKNDFRAVVERESETRDGSFGGGFVNSYVAKTPSDIEMGDWKAALNNGSGGVDQ
YDQTGHNDLRGHPRRSSWGRRSGSWDLTSDIASVASALGDSNRIVGGSSDNLGGQLTGQV
RR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtatggggtacatccacccaaaaattccgatgcagccgtcgccggtgatacggcggat
gtgatccgtacgtaccaggcctgggaaggcagcaacgtatttttccttggcggacggttt
atattcgggccggatatacaatcaatcttcctgtcaatatccctaatagttgttccggtt
gtaatattctgtgtattcgtcggcaggaagttacttgatgatttcaaccatcatctcgga
atattggttatggtcatagcaattgtattatcagtttatgttttaacgatgcttctagta
acttccggaagagacccaggaatcgttccccgcaacaaacgccctccagaaccagaagtt
gttctggatcaaagcttagacgttgggccgggccaaactccacagttacgtccacctcgc
tttaaagaagtaacagtcaacgggttgacagttaaagtcaaatactgtgatacctgcatg
ttatatagaccaccacgctgttctcattgttcgatatgtgataactgcgttgatcggttt
gatcatcattgcccgtgggtcggccagtgtattggattacgaaactacaggttctatttc
atgtttgtgtcttcagcaactctgctttgtatctatatcttcgccttttgttgggtgtat
gcgataaagataaagaatagcgaggatacatcgatatggggtgcgttaatcaagacccca
gcctcgattgtgctaataatttatacgttcatatgtgtatggtttgttggcggtcttaca
gtcttccatctttatctgatcagcacaaaccagtctacatatgaaaacttccggtacaga
tatgaccgaaccgaaaatccttataacagagggatcattgagaacttcaaggaggtattt
tggcgtagtattcctccttccaagaacgatttcagggcagtggtggaacgagaatcagaa
acccgagatggatcttttggtggcggttttgtaaattcctatgtagcgaaaactccgagt
gatatagaaatgggtgattggaaggctgctctgaataatgggtcgggtggagttgatcag
tatgatcaaacgggccataatgatctgcggggtcaccctaggcggtccagctgggggcga
agaagtggaagctgggatttaacaagtgatattgcttcggttgcatcggctcttggtgac
tcgaaccggatcgttggtggaagtagtgacaacttggggggtcaattgacgggtcaagtt
aggcgatga

DBGET integrated database retrieval system