KEGG   Helianthus annuus (common sunflower): 110880922Help
Entry
110880922         CDS       T05101                                 

Definition
(RefSeq) putative wall-associated receptor kinase-like 16
Organism
han  Helianthus annuus (common sunflower)
Brite
Enzymes [BR:han01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110880922
Protein kinases [BR:han01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110880922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase PIP49_C
Motif
Other DBs
NCBI-GeneID: 110880922
NCBI-ProteinID: XP_021985041
AA seq 219 aa AA seqDB search
MTLFSIEQLRKAINNYSQDQFIGKGGYGVVYKGVLAGKRVVVIKKSKLVDESQAEQFINE
VLMLTQVIHRNVVKLLGCCLEEEVPILVYEFISNNTLFHRIHQRLGGMNWLSWENRLRVA
TEAANALGYLHSEITMPIIHRDVKSTNILLDENYTAKILDFGASKLVPVDHDQVTTLIQG
TLGYLDPEYFNSSQLTEKSDVYSFGVVLAELITGKKPIG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgactttgtttagcattgaacagcttagaaaagcgattaataattattctcaagatcaa
tttattggtaaaggtggctatggtgtagtgtataaaggagttctggcgggtaagcgtgta
gtcgtgataaaaaagtctaaactagtggatgaaagccaagctgagcaattcatcaatgaa
gtcttgatgcttactcaagtcattcatcgaaatgtagtgaagcttttgggttgttgcttg
gaagaggaagtcccgatactagtttatgagtttatctccaataacactcttttccatcgc
attcatcaaagattgggtggaatgaattggttatcttgggaaaatcgattgagagtagcc
accgaagctgcaaatgcacttgggtaccttcattcagaaattactatgccaattatacac
agagatgtcaagtctaccaacatactattagatgagaactacacagcaaaaattttagat
tttggtgcgtccaagttagtcccagtagatcacgaccaagtaactactcttattcaagga
acgttagggtatttggatcctgaatacttcaactcaagccaactaactgagaaaagtgat
gtatacagctttggagttgtacttgcagaactgataaccgggaaaaaaccaattggttaa

DBGET integrated database retrieval system