KEGG   Helianthus annuus (common sunflower): 110881412Help
Entry
110881412         CDS       T05101                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:han00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110881412
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:han03041]
    110881412
Enzymes [BR:han01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     110881412
Spliceosome [BR:han03041]
 Complex C
  Other components
   Step II factors
    110881412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C
Motif
Other DBs
NCBI-GeneID: 110881412
NCBI-ProteinID: XP_021985372
AA seq 149 aa AA seqDB search
MNCLDATLVTIFQIHMEEGPGDILVFLSGQEEFESIEGLVHENLKKLPEANQKLLIYPLF
SSLPSEKQMKVFTPAPVGFRKVIPATNIVETSVRIPRVKYVIHPGLVKVCNYSPDSGIES
LIVVKTSKAQALQRRMIPYMLLPGKMGRY
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaactgtttggatgcaactttagttaccatatttcagatacatatggaggaagggcct
ggtgatatacttgtttttttatctggtcaagaagagtttgaatccattgagggtcttgtg
catgaaaatctcaagaaattacctgaagccaatcagaaactcttaatttatccattgttc
tcttctcttccatcggagaagcaaatgaaagttttcacacctgctccagttgggttcaga
aaggttataccggcaacaaacattgttgaaacatcagtaagaataccacgagtcaagtat
gttattcatcctggattggtaaaagtgtgcaattactctcctgacagtgggatcgaatct
ttgattgttgttaaaacttcgaaagctcaagctcttcaaagaaggatgatcccctatatg
ttgctgccaggcaagatgggaagatattag

DBGET integrated database retrieval system