KEGG   Helianthus annuus (common sunflower): 110883011Help
Entry
110883011         CDS       T05101                                 

Definition
(RefSeq) probable leucine-rich repeat receptor-like protein kinase IMK3
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
han  Helianthus annuus (common sunflower)
Brite
KEGG Orthology (KO) [BR:han00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:han01001]
    110883011
Enzymes [BR:han01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110883011
Protein kinases [BR:han01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110883011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 110883011
NCBI-ProteinID: XP_021986571
AA seq 182 aa AA seqDB search
MTSKSTYGFNYKATLENGDEVSVQTWSEYITKDGEYEVELNLLGKIRHPNVFAIRAYYLA
SEQEEYNHLVFYYMPEKSQLSVFLHHWATRMQIAKGVARGLHNLHTHHKLIHGNLTSHYV
LLDENNNHKISDFGMSRLMHAHVNSHHIAADKTLGYQAPEVSKLKEVDMKTDVHRLLGPS
LS
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcaaaagtacttacgggtttaactataaggcaacattggagaatggtgatgaa
gtttcagttcaaacatggagtgaatatattactaaagatggagaatatgaagttgaatta
aatttgcttggaaaaataaggcatcccaatgttttcgcaattagggcttattatttggcc
tcagaacaagaagaatataaccatctcgttttttattacatgcccgaaaaaagccagctt
tctgtatttctccatcattgggcaacaagaatgcaaatagcaaaaggagtggctagaggt
ttgcataacctccatactcatcacaagctaatccatggaaatctaacatcacactatgtt
ttgctcgatgaaaacaataaccacaagatttctgacttcgggatgtcacgactcatgcat
gctcatgtaaactcacatcatattgccgcagacaagactcttggctaccaggctcctgag
gtttccaagctcaaggaagttgatatgaaaaccgatgtccacaggctccttggaccttca
ttaagctaa

DBGET integrated database retrieval system