KEGG   Helianthus annuus (common sunflower): 110883118Help
Entry
110883118         CDS       T05101                                 

Definition
(RefSeq) cold-responsive protein kinase 1-like
Organism
han  Helianthus annuus (common sunflower)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Pkinase_fungal APH EVC2_like
Motif
Other DBs
NCBI-GeneID: 110883118
NCBI-ProteinID: XP_021986649
AA seq 437 aa AA seqDB search
MRELLEAISPTPLSLNEESSSRKHTPSAIFFFLGGLIVLLVLLVLIFVFWKFIRPARVNK
LKKRDTSCKDYFSGNLRTISYFSFQALKKATKNFHESNFLGKGGFGPVYLGKLQDGRLVA
VKKLSSDKSQQGDAEFLAEVRMITSIQHKNLVRLLGCCSHGPQRILVYEYMKNRSLDLII
YGKNDVYLNWSARFQIIIGIARGLQYLHEDSHIRIVHRDIKASNILLDDKFQPRIGDFGL
ARFFPEDEAYLSTAFAGTLGYTAPEYAIKGELSEKVDIYSFGVLVLEIISCRKNTDLSLP
SEMQYLPEYAWKLYERSRMADLIDPRMKSDGFVEKDVMQTIRVALLCIQPHANLRPPMSE
IVSMLTWKVEMVKSPIKPTFLNAGRRQTDDKESWEAVSDYFSSTLENESPNLTQPPNSID
SSNTISFSRKVGTFKNG
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaattacttgaagcaatatctccaacacccttgtcactcaatgaagaaagctca
tcaaggaagcacactccatctgccatcttctttttcctcggagggttaatcgtgctccta
gttttgctggtccttatattcgttttctggaaatttatcagaccagcgcgagtcaacaag
ttaaaaaagcgcgataccagctgcaaagattatttcagtgggaaccttaggacaataagt
tactttagttttcaagcgttaaagaaggcgactaagaactttcatgagtctaactttctt
ggaaaaggtggttttggtccggtttatttgggtaaactacaagatggaagactagttgcc
gtaaagaaactgtcttccgataagtcacaacaaggagacgcagagttccttgcggaagtg
agaatgatcactagcatacaacacaagaatctcgttcgccttcttggttgttgctctcat
ggacctcaaaggattctcgtctatgaatacatgaagaacaggagtctagacctcattatc
tacgggaaaaacgacgtgtatttaaactggagcgctcggttccaaataattatcggtatc
gctcggggattgcaatacctacacgaggactcacacatcaggattgtgcacagagatata
aaagcgagtaacattcttcttgacgataaatttcaaccgagaattggagatttcgggctg
gctagattcttccctgaagatgaagcttatcttagcactgcgtttgcgggaacgttaggc
tatacggccccagaatatgcgattaaaggagaactatccgaaaaggtcgacatttatagt
tttggcgttttggtgcttgaaatcattagctgcaggaagaataccgatcttagtttaccg
tcagaaatgcaataccttcctgaatacgcatggaagttgtatgagagatcaagaatggct
gacttaatcgatccaagaatgaagagcgatggttttgtcgagaaagatgtgatgcaaacg
attcgcgttgctctattgtgcattcagcctcatgcaaacttaaggccacccatgtcagag
attgtatcaatgctaacatggaaagtggaaatggtcaaatcgccgataaaaccgacgttc
ttgaatgcaggacgacggcaaacggatgacaaagaatcttgggaagccgtctctgattat
ttttcttctacactcgaaaacgaatcgcccaacttgactcaacctccaaactctatagat
tctagtaacaccataagtttttcaagaaaagttggcactttcaaaaatggttaa

DBGET integrated database retrieval system