KEGG   Helianthus annuus (common sunflower): 110883188Help
Entry
110883188         CDS       T05101                                 

Definition
(RefSeq) palmitoyl-acyl carrier protein thioesterase, chloroplastic-like
  KO
K10781  fatty acyl-ACP thioesterase B [EC:3.1.2.14 3.1.2.21]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00061  Fatty acid biosynthesis
han01100  Metabolic pathways
han01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    110883188
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:han01004]
    110883188
Enzymes [BR:han01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.14  oleoyl-[acyl-carrier-protein] hydrolase
     110883188
    3.1.2.21  dodecanoyl-[acyl-carrier-protein] hydrolase
     110883188
Lipid biosynthesis proteins [BR:han01004]
 Fatty acid synthase
  Component type
   110883188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-ACP_TE Band_7_1
Motif
Other DBs
NCBI-GeneID: 110883188
NCBI-ProteinID: XP_021986700
AA seq 234 aa AA seqDB search
MYVHDIIIKAASSSSSFWGLHVKDPTKVNATRVGVKDRSMLLPTIRTIPVKPMMVMINHK
KALPKLVSDLDLGRMVNDGLVFRQNIYIRSYEVGPDQTTSIETIMNHLQETALNHLKTIG
ILQDGFGSTPEMCKKNLIWVMTKMQLVVDRSPAWGDVVQVDTWKAASGKNGMRCNWMFRD
SKTGAILIRASSIWVMMNKETRRLFKELRIGLYAAYTDTLYTLRIGQYEAYKAF
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtgcatgatataattataaaggcagcatcttcttcttcttctttttgggggtta
catgttaaagatcctacaaaggtaaatgctactagagttggtgttaaagatcggagcatg
cttcttcccacgattcgaactatccccgtaaagccaatgatggtaatgatcaaccacaag
aaagcgcttccaaaactggtttcggatcttgatttagggagaatggttaacgacgggtta
gttttccgacaaaatatttatattagatcatatgaagttgggccagatcaaacaacttct
atagaaacaattatgaatcatttgcaggaaacagcccttaatcacttaaagacgattgga
atcttgcaagatggcttcggttcaacaccagagatgtgcaagaagaacctaatatgggtg
atgactaagatgcaactagtagtggaccgttctccagcatggggggatgttgttcaagtt
gatacttggaaagctgcatccgggaaaaatggtatgcgttgtaattggatgtttcgcgat
tccaaaacaggcgcgattttaataagagcgtcaagcatttgggtgatgatgaacaaagag
acaagaaggttattcaaagagctgcgtattggcctatacgcagcgtatactgacaccttg
tatacgctgcgtattggtcaatacgaggcgtataaagccttctga

DBGET integrated database retrieval system