KEGG   Helianthus annuus (common sunflower): 110883644Help
Entry
110883644         CDS       T05101                                 

Definition
(RefSeq) probable glycosyltransferase At5g20260
  KO
K18789  xylogalacturonan beta-1,3-xylosyltransferase [EC:2.4.2.41]
Organism
han  Helianthus annuus (common sunflower)
Brite
KEGG Orthology (KO) [BR:han00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:han01003]
    110883644
Enzymes [BR:han01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.41  xylogalacturonan beta-1,3-xylosyltransferase
     110883644
Glycosyltransferases [BR:han01003]
 Polysaccharide
  Structural polysaccharide
   110883644
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exostosin
Motif
Other DBs
NCBI-GeneID: 110883644
NCBI-ProteinID: XP_021987050
AA seq 239 aa AA seqDB search
MAAVTKSNITFALCSLLFLVILLYPTNHMHSFPSISYLTLTSTSRLLQDEAIPKIKKGDF
SLARIEEQLAKARGEIHKAIVEKSFESSNANESFIPEGTIYKNPFAFFQSHNEMIKTFKI
WTYKEGDLPLMHYGPMKFVYSIEGDFIEEMERKGNPVVARDPDEAHAFFIPISVTNIIHY
LYKPNETFGFLERMQAIVEDYIGVIAERYPYWNRSDGADHFFVSCHDWVRMYNLSQRIY
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagtaaccaaatcaaacatcacatttgccctatgctcacttctttttcttgta
attcttttatatccaacaaatcatatgcatagttttccatctatatcctatttgacatta
acatcaacctctaggcttctgcaagatgaagccatacccaagatcaaaaaaggagatttc
tcactggcgagaatcgaagaacagttagctaaagcacgaggcgaaattcacaaagcgatt
gttgagaagagctttgaatcaagtaacgcaaatgagagtttcatcccagaaggaaccatt
tacaagaatccatttgccttttttcaaagtcataatgagatgataaagacatttaaaata
tggacttacaaggaaggagatctccccttgatgcattatggtccgatgaaatttgtatac
agtatcgaaggtgacttcatcgaagagatggagagaaaaggaaatcctgtggtggctaga
gatccagatgaagcacatgccttctttataccaattagtgtaacaaacataattcactac
ctttacaagcctaatgaaaccttcggttttctagaaaggatgcaagcaatagtcgaagac
tacattggtgtcatcgcggaaagatatccttattggaaccgtagcgatggagcagatcac
ttctttgtctcatgtcatgattgggtacgtatgtataatctatctcaaagaatatattag

DBGET integrated database retrieval system