KEGG   Helianthus annuus (common sunflower): 110884409Help
Entry
110884409         CDS       T05101                                 

Definition
(RefSeq) cyclin-dependent kinase D-3-like
  KO
K02202  cyclin-dependent kinase 7 [EC:2.7.11.22 2.7.11.23]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han03022  Basal transcription factors
han03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:han00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    110884409
  09124 Replication and repair
   03420 Nucleotide excision repair
    110884409
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:han01001]
    110884409
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:han03021]
    110884409
   03019 Messenger RNA biogenesis [BR:han03019]
    110884409
   03400 DNA repair and recombination proteins [BR:han03400]
    110884409
Enzymes [BR:han01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     110884409
    2.7.11.23  [RNA-polymerase]-subunit kinase
     110884409
Protein kinases [BR:han01001]
 Serine/threonine kinases: CMGC group
  CDK family
   110884409
Transcription machinery [BR:han03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     110884409
Messenger RNA biogenesis [BR:han03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Capping factors
     110884409
DNA repair and recombination proteins [BR:han03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     110884409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 110884409
NCBI-ProteinID: XP_021987813
AA seq 406 aa AA seqDB search
MADLDQLLAKKVADRYLKREVLGEGTYGVVYKAIDTKTGQTVAIKKIRLGKQKEGVNFTA
LREIKLLKELKDPNIIELIDAFPHKGNLHLVFEFMETDLEAVIRDRNIVLSPTDIKSYLQ
MTLKGLAFCHKKWVLHRDMKPNNLLIGPRGQLKLADFGLARIFGSPDRRFTHQVFARWYR
APELLFGAKQYGPGVDVWAAACIFAELLLRRPFLQGSSDIDQLGKIFAAFGTPKETQWSD
MKYLPDYVEYQFVPGQPLKTLFPMANDDALDLLSKMFSYDPKARISAQQALEHRYFSSGP
PPTEPASLPRPPPKRESVDSKPSDFGPTVLSPTRKSKRVVSHPEGYVEKVDDHGVGNERS
GPVPMSLDFSVFEARPPARPTINSADRTHLKRKLDLEFLIPEEDED
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttggatcagttattagcgaaaaaagttgctgatcgatacttaaagcgtgag
gttcttggagaaggtacttatggagttgtgtacaaggccattgatactaagacaggacaa
actgttgcaataaagaaaattcgtctcgggaagcagaaggagggggtgaattttaccgct
cttagagaaataaagttactgaaagagcttaaagacccaaatataatagagctgattgat
gcttttcctcataaagggaatttgcatcttgtttttgagtttatggagactgatctcgaa
gctgttattcgcgatagaaacattgttctttcacccactgatataaagtcgtacctgcaa
atgacattaaaaggacttgccttctgtcacaagaaatgggttttacatagggatatgaaa
ccgaataatcttttgataggacctcgcgggcaattaaaacttgcggattttgggctggca
agaatatttggtagtcctgaccgaaggtttactcaccaggtttttgctcgatggtataga
gcacccgagctattatttggtgcaaaacagtacggtcccggggttgatgtttgggctgca
gcttgtatatttgcagagcttcttttacgccgcccttttctgcagggtagcagtgacatc
gatcaattggggaaaatctttgctgcatttgggactccaaaagaaactcaatggtcagat
atgaaatatctccctgattatgtcgagtaccagtttgtccccgggcaaccgcttaaaaca
ttgtttccaatggctaatgatgacgcgttggatctgttatccaagatgttttcatacgat
ccaaaggctagaatttcagcacaacaggcattagagcataggtacttctcatctggaccg
ccacctactgaaccagcatcgcttccgagaccgccaccaaaaagggagtctgtagattca
aagccttcagattttggtccaactgtgctatcacctacaagaaagtcgaaaagagtggtg
tcgcaccctgaaggatatgttgagaaggttgatgaccatggcgttggtaatgaacgaagt
gggcccgtcccaatgtcgctagatttttcggtctttgaagcaaggcctccagctagacca
acaattaacagtgctgacagaactcatctgaaaagaaaactagaccttgagttcctaatc
cctgaagaagatgaagattga

DBGET integrated database retrieval system