KEGG   Helianthus annuus (common sunflower): 110886967Help
Entry
110886967         CDS       T05101                                 

Definition
(RefSeq) receptor-like protein kinase HERK 1
Organism
han  Helianthus annuus (common sunflower)
Brite
Enzymes [BR:han01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110886967
Protein kinases [BR:han01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110886967
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 110886967
NCBI-ProteinID: XP_021990548
AA seq 563 aa AA seqDB search
MASATTFTKFAHLQFPLADVLKATNNFHPDNIIGRGGLGPAYKGQLRRAGKLVKISALRL
DRKHGGRDVEFWTEISALSDLDHPNIVSIIGFCDEKNEKVIITSYAAKGSLKGHLDSPKL
TWTQRLKICVGVARALSYLHYDERRGYGVIHLNVNSSTILLDENLEARLSGFKVSIKQSL
NRMDHVVLSDPIGTIGYLDPAIETTKGVTHKSDIYSFGVVLFEILCGRKAFIRDEANRFL
APLAKSHYENETLQDIILPALLDQMSPQSLRRYSKTSYFCLKEERAHRPHMLHIVDELEK
ALNFQPGLEDFLGKDQVVGELENAAHEIPEEGVERSYMDEFAYKHKNAMQPQSMHEIIKN
KANLRISFEDVNQATQNFHRNNCIGGGGFGKVYKGNLKDGDGFKTIVAKRLDTKLGQGEQ
QFLSELQILLEYKHENVIGLIGYCDENNEKIIVFEYAPKGSLDRYLSDVSLTWVERLNIC
IDVASALYFFHGGVGKQARVIHRDIKSANILLNDGWKAKLADFGLSLISPLTHEIDYIID
HACGTEGYLDPLYREKGFLTLEL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggcatcagctacaacgttcaccaagtttgctcacttacaattcccacttgcagatgta
ttaaaggccaccaacaactttcatcctgataacatcatcggacgaggtggactgggacca
gcatacaaaggacaactccgacgggccgggaagttggtgaagatttccgctctgaggtta
gatcgtaagcacggaggaagggacgtcgaattctggacggaaatttcagcactttctgat
ctcgaccatccaaatatcgtttctattattggattttgcgacgagaaaaatgagaaggtc
atcatcacctcatatgcagccaaaggaagtctcaaggggcatctagacagcccgaagctc
acatggacgcaaagactgaagatatgtgtaggcgtggctcgtgctctgagttacctccat
tatgatgagagacgtggttatggtgttatacatcttaacgtcaacagctccacaatttta
ttagatgagaatttggaagccaggttatctggttttaaagtttccatcaaacaatctcta
aaccgaatggaccacgtcgtcctttccgaccctattggcacaatagggtatttggaccca
gcaatagaaacgaccaaaggtgtgacccacaaatcagacatctactcattcggtgtggtg
ttatttgaaatattgtgcgggaggaaagcgtttattcgtgacgaggctaataggtttcta
gctccgttggcaaaatctcattatgaaaacgaaacattgcaggatataatccttcctgct
ctattggatcaaatgtccccgcaatccctcagaagatactcaaaaacatcgtatttttgc
ttaaaggaagagcgtgcacaccgcccacatatgctccatattgttgatgaacttgagaaa
gcattaaactttcagcctggacttgaagattttctgggtaaagaccaagttgtcggcgag
cttgagaatgcagcacacgaaattcctgaggagggagtagaacgctcgtatatggatgaa
tttgcatataaacataagaatgcaatgcaacctcaaagcatgcatgaaattattaaaaac
aaggcaaacctaagaatttcatttgaagacgtaaatcaggccacccaaaacttccataga
aataattgcattgggggcgggggttttgggaaagtctacaaaggaaaccttaaagatggt
gatggttttaaaaccattgttgcaaagcgattggatacgaagcttggtcaaggcgaacaa
caatttttgagtgagctccaaattcttttggagtataagcatgagaatgtcattggcctt
ataggctattgtgatgaaaataatgaaaaaatcattgtttttgagtatgcacccaaagga
agtcttgataggtatttgagtgatgtttctcttacatgggtggaaaggcttaacatatgc
attgatgttgcaagtgcgttgtatttctttcatggaggagttggaaaacaagcgagggtg
atacatagggacatcaaatctgctaacattttactaaatgacggctggaaagcgaaactt
gctgattttgggctttctttgataagcccattaactcatgaaatcgactatatcattgat
catgcttgtggcacagagggatacttggacccactttacagagaaaaaggattcttaact
ctagaattgtaa

DBGET integrated database retrieval system