KEGG   Helianthus annuus (common sunflower): 110891932Help
Entry
110891932         CDS       T05101                                 

Definition
(RefSeq) beta-caryophyllene synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    110891932
Enzymes [BR:han01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     110891932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth WIYLD DUF1456
Motif
Other DBs
NCBI-GeneID: 110891932
NCBI-ProteinID: XP_021995087
AA seq 546 aa AA seqDB search
MSFQQEVIRPLRYMQPSVWGDQFLIYNKKAQLADEVDRLVDDLKEEVRKDILAALDVPEE
HTRLLKLIDTIQRLGISYYFEEDIDKALQHVYEAYGDDWNGSNPSLWFRLLRQHGFYISC
DVFDNFKDEQGAFKESLTSDVEELLELYEATHMRVQGETVLDEALIFTRTRLAEIAKDPI
RSNSTMSSHIQEALEQPLRKRLPRLEALRYIHFYQQASHNESLLKLAKLGFNMLQSLHKM
ELSQLSKWWKGIDVPNNLPYARDRLVESYFWALGVYFEPKYSLARIFLTKVIAMATVIDD
TYDAYGTYEELEIFTEAVMRWSVTCLDMLPGYMKLIYQRLLDMYKEMEEILEKEGKTDLF
NCAKEFMKTFIKGYMMEAKWLHEGYIPTTEEHASVAYVTGGGSILITSCFLGMADIVTDR
SIKWALTEPPLFKASSKIGRLLNDIAGHKEEQERKHFPSSVESYKKQYDVTEEYAYDLLH
KQIEDVWKDVNRESLLCKDVSMPILMVTVNLIRTLEVLYKDNDNFTHAGEEFISHINSLL
IHAISI
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttcaacaagaagttattcgcccacttcgttacatgcaacccagtgtttgggga
gaccagtttctcatctataacaagaaagcacagctggccgatgaggtggatcgattagtt
gatgatttgaaagaagaagtaaggaaagatattctggcagctttggatgttccagaggaa
catacgcgtttgttaaaactaattgacacaatccaacgccttggtatatcatattatttt
gaggaggatattgataaagctttgcagcatgtttatgaggcttatggtgatgactggaat
ggtagtaacccttcgctttggtttcgactcctacgccaacatggcttctatatttcatgc
gatgtttttgataattttaaggatgaacaaggagcttttaaagagtccttaactagtgat
gttgaagaattgcttgagttgtacgaggcaacacacatgagggtacaaggtgaaactgta
ctagatgaagcgcttatttttactagaactcgtctagctgaaatcgcaaaggatcctatt
cgtagcaactctaccatgtcgtcccacatacaagaagcactagagcaacctttacgtaag
aggttaccaagactagaagcgttgcgctacattcatttctaccaacaagcttctcataat
gagtcactacttaagcttgccaagttaggattcaatatgcttcaatcattacacaaaatg
gagcttagccaactttccaagtggtggaaaggaattgatgtcccgaacaatctaccttat
gcaagagatagattggttgaatcctacttttgggcacttggtgtatactttgaaccaaag
tattctcttgctagaattttcttgacaaaagtgattgctatggcaacagttattgatgac
acttacgatgcttatggtacatacgaagaacttgagatctttacagaagcagttatgaga
tggtcggttacatgcttagacatgcttccaggatacatgaaactgatataccaaagacta
cttgatatgtataaggaaatggaagaaatcctggaaaaggagggaaaaacagaccttttt
aactgtgccaaggagtttatgaaaacgtttattaaaggctacatgatggaagcaaaatgg
ttacatgaggggtacataccaacaacagaagagcatgcttcggtagcatacgtcacaggc
ggtggtagcatacttataacatcatgttttctaggcatggctgatatagttacggataga
tcgatcaaatgggctctcactgaacctccacttttcaaagcctcatcaaaaattggtaga
cttctaaatgacattgcaggtcacaaggaggagcaagagagaaagcatttcccatcaagt
gttgaaagttacaagaagcaatatgatgttaccgaagagtatgcctacgacttgttgcac
aagcaaatagaagatgtgtggaaggatgtaaaccgagaatccctcttatgtaaagatgtt
tcgatgccaatactaatggttacagtcaacttgataaggacattggaagttctgtataaa
gataacgataactttacacatgcgggagaagaatttataagtcatataaattcgttgctc
attcatgctataagtatatga

DBGET integrated database retrieval system