KEGG   Helianthus annuus (common sunflower): 110892827Help
Entry
110892827         CDS       T05101                                 

Definition
(RefSeq) putative receptor protein kinase ZmPK1
Organism
han  Helianthus annuus (common sunflower)
Brite
Enzymes [BR:han01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110892827
Protein kinases [BR:han01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110892827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PAN_2
Motif
Other DBs
NCBI-GeneID: 110892827
NCBI-ProteinID: XP_021995663
AA seq 420 aa AA seqDB search
MVNSKDWSYGCEPNSQICRPEDEDFVELRYVEFFYGYDIRYHENYTLDACKTDCLHDCAC
KGFQFGYVVDDVGTYYCYIKTFLYNGYQMGFYNSMYIKLPKTFVSSFKQKPMNKSNFHCS
GTTVTPIIRSYENKPDNKILRFLLIIGCVIAFIEIICIIFFWIKTRKSPVLADQSYSLAV
TPFRKFTYRELKKASSNFRDEIGRGSASIVYKGRLADNRVAAIKKLKSMANKQNETEFQA
EISTIGRLNHMNLIETWGYCAEGPHRLIVYEYMETGRWLKSYAMGSLIGTSFLKSQEPHN
ILLDGNYNPKVVDFGLSKLLDRGDIKKSRFLTIRGTRGYMAPEWVFKLPITSKVDVYSYG
VVVLEMITGRGPGGKKQRADHEDGDLELGVVEWVRDRVRDGDGSASESWVEDVLDGLIGG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggtgaattccaaagactggagttacggatgtgaacccaattctcaaatttgcagacct
gaagacgaagattttgtcgagcttcgatatgtcgaattcttctacggctacgatatccgg
taccacgaaaactacaccctggatgcttgcaaaaccgattgcttacatgattgtgcttgc
aaaggcttccaatttggatacgttgttgatgatgttggaacctattattgctacattaag
acttttctgtataacggataccaaatgggattctacaattcgatgtatatcaaactacca
aaaacatttgtttcatcttttaagcagaaacccatgaacaaatccaactttcattgctca
ggaacaacagtcacacccattataagatcctacgaaaataaaccggataacaagatactt
cgattcttgctcataatcggatgtgtcatcgcgtttatcgagatcatttgcatcatcttt
ttctggatcaagacccgtaaaagcccagttttagccgatcaaagttattccctggctgta
acaccattcagaaagttcacatatcgcgagctgaagaaggcgtcgagtaactttagggat
gagatcggacgaggtagcgctagcattgtgtataaaggaagattagccgataacagagtt
gcagctattaaaaagctcaagagcatggctaacaagcaaaatgaaactgaatttcaagcg
gaaattagcacaattgggcgactgaaccatatgaatttaatcgaaacatggggttattgt
gccgaaggaccacatagacttatcgtttacgagtacatggaaacgggccgttggctgaaa
agttacgcgatgggaagcttgattgggacatcatttttgaaatcgcaagagcctcacaac
atattgttggatggaaactataatcctaaagttgtggatttcgggctttcaaaactgttg
gatagaggtgacatcaagaaatcaagattcttaacaattagggggactcgaggctacatg
gcacccgaatgggtgttcaagcttccaatcacatcgaaagtcgatgtgtatagctacgga
gtggtggttttggaaatgataacgggtcggggcccaggagggaagaagcaacgggctgat
catgaagatggtgaccttgagctcggtgtggtcgagtgggtgagggacagggtaagagat
ggtgatggaagtgcttcggaatcttgggttgaggatgtcctagatggtttgataggcggc
tag

DBGET integrated database retrieval system