KEGG   Helianthus annuus (common sunflower): 110893972
Entry
110893972         CDS       T05101                                 

Definition
(RefSeq) alpha-copaene synthase
  KO
K22065  alpha-copaene/(+)-delta-cadinene synthase [EC:4.2.3.133 4.2.3.13]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00909  Sesquiterpenoid and triterpenoid biosynthesis
han01100  Metabolic pathways
han01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    110893972
Enzymes [BR:han01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.13  (+)-delta-cadinene synthase
     110893972
    4.2.3.133  alpha-copaene synthase
     110893972
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-GeneID: 110893972
NCBI-ProteinID: XP_021996829
AA seq 555 aa
MATTEANTMAQANSQTTIEPVRHLANFPPSIWGDQFLSFSLDNSQLEAYSKAMEQPKENV
RRMILNPAIDTNEKLGLIYCVYRLGLTYNFSKDIDGQLDELFKQLNLQSYNEADLYTISI
HFQVFRHFGYRFSCDVFNKFKDSSSGKFKEDMTRDVRGMISLYESAQLRIRGESILDEAG
AFAESKLKTIEKTLDGTLAQQVKHVLERPFNRGHQMVEARKYLFLFEEEISRYDSLLMLA
KVHFNYLQLLQKEELRSVSKWWKDLDLPAKTLYVRDRVPELYVWILAFFLEPYYSEVRII
TTKIVLLVLVLDDTYDAYATIEESRLLTHAINRWEVSAMLQLPEYMKPLYEILLNEYDGF
YKHGRTNVIETSKKAFQDLARSYHQESEWRHAKEVPSFEEYMKIGTTTSAHNVLSKTALI
GMGNIVTREALAWYESYPKIVQLSELIGRLEDDVVSVEFERERAPTATSVDAYMKTYGVS
ENVAVKILKKLVENGWKDLNEACLKPTEVSLDLLAPIIGLTNMTDVAYRHNDGLTFPEKT
LKEYITLLFCVPVPM
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggcaacaactgaagctaacactatggcgcaagctaactcacaaaccaccatagagccg
gtgcgtcatctggcaaactttccgccttcgatttggggtgatcagtttctatcattctct
cttgacaattcccaattggaagcatacagtaaagctatggagcagccaaaagaaaacgtt
agaagaatgatattaaaccctgctattgatacaaatgagaaattgggtttgatttattgt
gtctatcgtcttggtttgacgtataatttctcaaaagatattgatggtcaacttgatgaa
cttttcaaacagcttaacttgcaaagttacaacgaagcagatctctatacaatatccatt
cactttcaagtttttagacactttggttatagattttcttgtgatgtgtttaacaagttc
aaggactccagttctggtaaattcaaggaagacatgactagagatgtgaggggtatgata
agtttgtatgagagtgcccaactaagaataagaggagaatctatactagatgaagccggt
gcattcgcagaaagtaaacttaaaacgatagaaaaaacacttgatggtacacttgcacaa
caagtcaaacatgtattggagagaccttttaatcgagggcatcagatggttgaagcgagg
aagtatttgttcctatttgaagaagaaatttcacggtatgattccctattgatgcttgca
aaggtgcattttaactacttgcaactcctacaaaaggaagaacttcgatctgtatcaaag
tggtggaaagacttggacctaccggcgaaaacactatatgtaagagatagagtacctgaa
ctctatgtatggattttggcgtttttcttggagccgtattactctgaagtccgaataata
acgaccaaaatcgtactgcttgtattggtgttagatgacacgtatgatgcatatgctact
attgaggagagccgacttctaacccatgcaataaataggtgggaagttagtgctatgttg
caacttccagaatacatgaaaccattgtatgaaattttgctcaacgagtatgatggattt
tacaaacatggaagaacaaatgtcattgagacttcaaaaaaagctttccaagacttggct
agaagttaccatcaagagtctgaatggagacatgctaaagaggtgccatcatttgaagag
tatatgaaaattgggacaactacttctgcacataatgttcttagtaagactgcattgatt
ggtatgggcaacattgtaacacgcgaggctttagcttggtacgaaagctatccaaagatc
gtacaactttcagagttgatcggaaggctcgaagatgatgtcgtcagtgttgagtttgag
cgtgaaagagctccaacagccacaagtgtagatgcttatatgaagacttatggggtgtcg
gaaaatgtagctgtcaagatactcaaaaaacttgttgaaaatggatggaaagatctaaat
gaggcgtgtctaaagccaacagaggtctcattggatctgcttgctccgattattggtctt
acaaacatgacagacgtggcgtacaggcacaatgatggtttaacttttccagaaaagact
cttaaggaatatattacactcctgttttgtgttccagtccccatgtaa

DBGET integrated database retrieval system