KEGG   Helianthus annuus (common sunflower): 110898120Help
Entry
110898120         CDS       T05101                                 

Definition
(RefSeq) tyrosine decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00350  Tyrosine metabolism
han00360  Phenylalanine metabolism
han00380  Tryptophan metabolism
han00950  Isoquinoline alkaloid biosynthesis
han00965  Betalain biosynthesis
han01100  Metabolic pathways
han01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    110898120
   00360 Phenylalanine metabolism
    110898120
   00380 Tryptophan metabolism
    110898120
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    110898120
   00950 Isoquinoline alkaloid biosynthesis
    110898120
   00965 Betalain biosynthesis
    110898120
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:han04147]
    110898120
Enzymes [BR:han01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     110898120
    4.1.1.105  L-tryptophan decarboxylase
     110898120
Exosome [BR:han04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110898120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 110898120
NCBI-ProteinID: XP_022000563
AA seq 486 aa AA seqDB search
MENLKAMDAEQLRENAHKMVDFIADYYKNIETFPVLSQVEPGYLQKLLPDSAPMQPESLQ
AVLQEVESAILPGVTHWQSPDYFAYFPSNSSVAGFLGEMLSAGINMVGFSWITSPAATEL
EMIVLDWLANLLNLPQHFLSKGPGGGAIQGTASEALLVVLLASRDKVLRQVGKDALRRLV
VYGSDQTHSSLQKACQIAGVHPENLRLLRTERCNEYALSPESLTDAISHDVASGLIPLFL
CATVGTTSSTAVDPLLALGKITKRYGIWFHVDAAYAGSACICPEYRHHLNGIEEADSFNM
NCHKWFLTNFDCSALWIKDRNALIQSLSTNPEYLKNKASQGSTVIDYKDWQIPLGRRFRS
LKLWMVLRLYGVENLQSYIRNHIKLAQHFEHLVAQDSRFEIVATRTFSLVCFRLLPSNKT
EEYVNKLNHDLLDAVNSSGKIFISHTVLSGKYILRFVVGAPLTEERHVIAAWKLFQEAAS
SLLENS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggagaatctgaaggcaatggatgcagagcaactgagagaaaatgcgcacaaaatggtg
gatttcattgctgattactacaagaacatcgagactttccctgttctcagccaagttgag
ccaggatatctacagaagcttcttcctgattctgcaccaatgcagcctgaatccttgcaa
gcagttcttcaagaagttgaaagtgcgatattaccaggagttacccactggcaaagccca
gattattttgcgtattttccatcaaatagcagcgttgcagggtttcttggagaaatgctt
agcgctggaattaacatggtcggatttagttggatcacttctccagctgctacagaactc
gaaatgattgttcttgattggctcgctaacttactcaaccttccccaacatttcctttcc
aaggggccaggtggtggtgcgattcaagggaccgcaagtgaagcccttctcgttgtgcta
ttggcttctcgggataaagttttaagacaggttggtaaggatgcccttcgaaggcttgtc
gtttacggttctgatcaaactcactcctctttacaaaaggcttgccaaatagcaggagtt
catcccgagaatcttaggctgctaagaacagaaaggtgcaatgagtatgcactctctcca
gaatcactcactgatgcaatctcacatgacgtcgcctctggtttaatccctcttttcctt
tgtgctacagtaggtaccacatcatcaacggctgtggatcctttgctcgcacttggaaag
attacaaagagatatggaatatggtttcacgtggatgctgcatatgcaggaagtgcttgt
atttgccctgaataccgtcatcatttgaatggtattgaagaagccgattcatttaacatg
aattgtcataaatggtttctaaccaacttcgattgttcagcactatggataaaggaccga
aacgccctcattcagtctctttcaacaaatccagagtatctaaagaataaagcttctcaa
ggtagtacagttatcgattacaaagactggcaaattcctctcggacgcagatttagatct
ctgaaattgtggatggtattacggctttatggggtcgaaaatcttcagtcttacataaga
aaccatatcaaattagctcaacactttgaacatcttgttgctcaagactcaaggtttgag
atcgttgctactcggaccttttcattagtttgctttcgtcttctaccctccaacaaaacc
gaagaatatgtcaacaaactcaaccatgacctcttggatgcggtcaactcatccgggaag
atcttcatctctcatacggttctatcgggtaagtacatcctacgcttcgttgtaggagct
ccattgacggaagagagacatgttattgcagcttggaaactttttcaagaagcagcctct
tctcttttggagaattcatag

DBGET integrated database retrieval system