KEGG   Helianthus annuus (common sunflower): 110898214
Entry
110898214         CDS       T05101                                 

Definition
(RefSeq) germacrene A oxidase
  KO
K15800  germacrene A oxidase [EC:1.14.14.95]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00909  Sesquiterpenoid and triterpenoid biosynthesis
han01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    110898214
Enzymes [BR:han01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.95  germacrene A hydroxylase
     110898214
SSDB
Motif
Pfam: p450 Phage_hub_GP28
Other DBs
NCBI-GeneID: 110898214
NCBI-ProteinID: XP_022000663
AA seq 488 aa
MEVSLTTSIALATIVFFLYKLLTRPTSSKNRLPEPWRLPIIGHMHHLIGTMPHRGVMDLA
RKYGSLMHLQLGEVSAIVVSSPKWAKEILTTYDIPFANRPETLTGEIIAYHNTDIVLAPY
GEYWRQLRKLCTLELLSVKKVKSFQSLREEECWNLVQEIKASGSGTPFNLSEGIFKVIAT
VLSRAAFGKGIKDQKQFTEIVKEILRETGGFDVADIFPSKKFLHHLSGKRGRLTSIHNKL
DSLINNLVAEHTVSKSSKVNETLLDVLLRLKNSEEFPLTADNVKAIILDMFGAGTDTSSA
TVEWAISELIRCPRAMEKVQAELRQALNGKERIKEEEIQDLPYLNLVIRETLRLHPPLPL
VMPRECRQAMNLAGYDVANKTKLIVNVFAINRDPEYWKDAESFNPERFENSNTTIMGADY
EYLPFGAGRRMCPGSALGLANVQLPLANILYYFKWKLPNGASHDQLDMTESFGATVQRKT
ELMLVPSF
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggaagtctccctcaccacttccattgcactagccaccattgtcttcttcctttacaag
ctcctcactcgtcccacatcctccaaaaaccgccttcctgagccatggcgtctccccatc
atcggtcacatgcatcatctgatcggcacaatgccacatcgcggggttatggacttagcc
cgaaaatacggatcattgatgcatctacagctcggtgaagtctccgcaatcgtagtatcc
tctccaaaatgggccaaagagatcctaaccacatacgacatccccttcgcaaacagaccc
gagactctaacgggtgagatcatcgcatatcacaacacggacatagttcttgcaccctac
ggcgaatactggcgacaattacgcaaactttgcactctagagcttctaagtgtaaagaaa
gtgaagtcattccaatcactccgtgaagaggaatgttggaacttggttcaggaaatcaaa
gcatccggttcgggtacaccctttaatctttccgagggtattttcaaggtgatcgcgacg
gttttgagtcgcgcggcttttggaaaggggatcaaggatcagaaacagtttactgagatt
gtgaaggagatattgagagaaactggtgggtttgatgtggcggatatctttccatctaag
aagtttttgcatcatctttcgggcaagagggggaggttgacgagtattcataacaagctt
gatagcttgattaataatcttgtggctgaacacactgttagtaagtcgagtaaagtgaat
gagactttgcttgatgtgttgctgaggcttaaaaatagtgaggagttccctttgactgct
gataatgttaaagccatcattttggacatgttcggagccggaaccgacacctcctccgcg
acagtcgaatgggcgatttccgagctaataaggtgtccgcgagcgatggagaaggtacaa
gccgaactaaggcaagcgttgaacggtaaagagcgaatcaaagaagaagaaattcaagac
ttgccctacttaaaccttgtgatccgagaaacactacggttgcatcctccactacctttg
gtcatgccaagagagtgccgacaggcaatgaatctagctggatacgatgtagccaacaag
accaaactcattgtcaacgtgtttgcaataaaccgggatcccgaatactggaaagacgct
gaaagtttcaaccccgagaggtttgaaaacagcaacacaaccattatgggtgcggattat
gagtatcttccgtttggggctggaaggaggatgtgtccaggatcggcactcggtctagca
aacgtgcaactaccgttggctaatatactttattactttaagtggaaactccccaatggt
gctagccatgaccaacttgacatgaccgagagctttggagccacggttcaaaggaagact
gagttgatgcttgtaccaagtttttaa

DBGET integrated database retrieval system