KEGG   Helianthus annuus (common sunflower): 110900873Help
Entry
110900873         CDS       T05101                                 

Definition
(RefSeq) polygalacturonase-like
  KO
K01184  polygalacturonase [EC:3.2.1.15]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00040  Pentose and glucuronate interconversions
han01100  Metabolic pathways
Module
han_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110900873
Enzymes [BR:han01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.15  endo-polygalacturonase
     110900873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_28 zf-RVT Pectate_lyase_3 NosD
Motif
Other DBs
NCBI-GeneID: 110900873
NCBI-ProteinID: XP_022003423
AA seq 516 aa AA seqDB search
MVWTGWVPLKVNIHVWRLEMDRLPTKLALRSRNINVGNEFCAFCQSEEESALHLFTGCIL
TIGIWHFIERWCHLNPIFLLEIKDILKLPYSIHGCKWKKIIIRGIVMTACWVIWKTRNKA
IFEEVQPRSRLLVTFMKLQMGPKEIAKKKFKKHRRKSKPDGRSDSKNAFLKAWSLSCNST
IPASIYVPAGRYLVASALTFSGQGCKSRAITFNIAGNLVAPSSYNAIGNAQVWIKFYIVK
NVTINGGTLDAQGSSLWACKTSGKACPKGSTTLGFYHSQNIVISKLRSLNSQMFHMLLYS
CKNAKIQGVSIVAPGLSPNTDGIHLTYSTGITILSSKISTGDDCVSIGPGNSNIWIEKVV
CGPGHGISIGSLGWERDEPGVQNVTVKTTTFVGTTNGLRIKAWARSSNGFVNGVYFKGAT
MMNVKFPIIIDGNYCPNNNNCPNEASGVKISNVMYENVHGTSAIRVAVKFDCSKGNPCSG
IVLKDVDLKFGGQPANSSCSYAAGTASGLLQPTSCL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggtttggaccggatgggttcctcttaaagtcaacatacatgtatggaggcttgagatg
gaccggttacccactaagttagcgctcaggagtcgaaacataaacgtgggaaacgagttt
tgtgcgttctgccaatcggaggaggaatcggctcttcatctgtttacaggatgcattctt
accattggcatttggcatttcatcgaaagatggtgtcatttgaatcctatttttcttctc
gagattaaagatattctgaagctcccttactcgatacacggctgcaaatggaagaagatc
attattagagggattgtaatgacggcttgttgggtgatttggaagactcgaaataaggct
atttttgaagaggttcaaccaaggagtcggttgctagtaacgtttatgaaactccaaatg
ggcccaaaggaaatagcaaaaaagaaattcaaaaaacataggaggaaatccaagccagac
ggccgctcagactcaaagaacgcgttcttgaaagcatggagtttgtcatgtaactctacc
attcccgctagcatttatgtaccagctggaaggtacttggttgcctcggcgcttacattc
tctggtcaaggatgtaagagccgagccatcacattcaacatagctggtaacttggtggca
ccatctagttataatgctattggcaacgcgcaagtctggatcaagttctacatagttaag
aatgttaccataaacggtgggacccttgatgcccaaggatcttctctatgggcatgcaaa
acatctggaaaagcatgtcctaaaggatctacgacacttggcttctaccattcccaaaac
atagtgatcagtaaattaaggtcattaaacagccaaatgtttcacatgttgctctatagt
tgcaagaacgcgaaaatacaaggagttagcatcgtagcacctgggctcagcccgaacaca
gatggcatccatttaacatattccacaggaatcaccattttgagctctaaaatctcaaca
ggcgacgactgcgtctcgataggcccaggaaactctaatatctggatagaaaaggtggtt
tgtggacccggtcacggcataagcattgggagtctagggtgggaacgagatgaaccaggt
gtccagaatgtaacagtaaaaacgaccacattcgtaggtacaacaaatggtctgaggata
aaagcatgggcaaggagtagcaatgggttcgttaacggtgtttatttcaagggagcaacg
atgatgaatgttaagttcccgatcataatagacggaaattactgtccgaataataacaac
tgtccgaatgaagcttcaggagtaaagatcagcaatgtgatgtacgaaaacgtgcatgga
acatcagcaatacgcgtagcagtgaagtttgattgcagcaaggggaatccgtgtagtgga
attgtgttaaaggatgttgaccttaaatttggaggtcaaccagcgaattcgtcttgctcg
tatgctgcaggcactgcttctggattacttcaacctacaagttgcctgtaa

DBGET integrated database retrieval system