KEGG   Helianthus annuus (common sunflower): 110902949Help
Entry
110902949         CDS       T05101                                 

Definition
(RefSeq) probable glycosyltransferase At5g11130
  KO
K18789  xylogalacturonan beta-1,3-xylosyltransferase [EC:2.4.2.41]
Organism
han  Helianthus annuus (common sunflower)
Brite
KEGG Orthology (KO) [BR:han00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:han01003]
    110902949
Enzymes [BR:han01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.41  xylogalacturonan beta-1,3-xylosyltransferase
     110902949
Glycosyltransferases [BR:han01003]
 Polysaccharide
  Structural polysaccharide
   110902949
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exostosin Herpes_UL56 TipE
Motif
Other DBs
NCBI-GeneID: 110902949
NCBI-ProteinID: XP_022004930
AA seq 452 aa AA seqDB search
MATDGWKTGYKSPLFYTTIFLILFFVCLNTQFNFFTFSFLKPYLIPPAPASPPLPSSTIM
IKKEDMVEERLSRARAAIRAAGRMRRYTMSWRLRDRSFTPRGSVYRNPYAFHQSHIEMEK
SFKIWTYKEGELPIFHGGPMKNIYSSEGQIIDEIESKKSRFFTQNPDEALVFFLPVSVVF
IRHYLYRTHADYDRHIIQDVVTDYIGVLSNKYPYWNRSSGADHFFVSCHDWAPDVSATNP
KLYKHFIRVLCNANSSEGFRPERDVSLPELNIPYDQLGPPLTGQPPENRSILAFFAGGNH
GHVRKYLFETWLGKDNDLKVFTYLPKTLNYTELLGRSKYCLCPSGYEVASPRIVESISAG
CVPVIVSDHYVLPFSDVLDWSKFSVHVPVEKIPDIKKILEGIGKDDYLKMQKMVMKVQRH
FIVHRPSRPYDLIDMVLHSVWLRRLNVKLSGF
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagacggctggaaaaccggttacaaatctccattgttttacacaacaattttt
ctcattctcttcttcgtttgcctcaatacccagttcaatttctttacgttttctttttta
aaaccctatttaatcccccctgctccggcgtcaccaccgctgccgtcctctaccattatg
attaagaaagaggatatggtggaggaacggttgtctagagctcgtgccgccatacgagca
gccggtcgaatgaggagatatacgatgtcgtggcgtcttcgtgaccggagttttactccg
agaggatcagtttacagaaatccttatgcttttcatcagagtcacatagagatggagaag
agtttcaaaatatggacatacaaggaaggagaactacctatttttcatggaggacccatg
aagaatatctactccagtgaaggacaaatcattgacgaaatcgagagtaaaaaaagccgt
tttttcacacaaaaccctgatgaagcactcgtgttctttctccccgtcagcgtggttttc
attcgacactatctttatagaactcatgctgattatgatcgccatatcatccaagatgtt
gtcactgattacattggagttttatccaacaagtacccttattggaatagaagtagtgga
gctgatcacttctttgttagctgccatgattgggcacctgatgtttcagcaacaaatcct
aagctttacaaacacttcattcgagtgctatgcaatgccaacagttctgaaggttttcgg
cccgaaagagacgtctcattgccagaactcaacatcccttatgaccagctcggcccaccc
ctcactggacaaccacccgaaaaccgctcaatcctagcctttttcgcgggtggcaaccac
ggacatgttagaaaatatttatttgaaacctggctaggcaaagataatgaccttaaagta
tttacttacctcccaaaaaccctaaactatacagaattattgggtagatcaaagtattgc
ttgtgtcctagtggatatgaagtagcaagcccaagaatagttgaatcgatttcagcgggt
tgtgttccggttattgtttccgaccattatgtattaccatttagtgatgttcttgactgg
agcaagttttcggttcatgttcctgtggagaagataccggatattaagaaaatcttggaa
ggtattgggaaggatgattatttgaaaatgcagaaaatggtgatgaaggtgcaaagacat
tttatagttcatagaccatcaagaccgtatgatttgatagatatggtgcttcattcagtt
tggttaagaaggctcaatgtaaaattgtcaggattttaa

DBGET integrated database retrieval system