KEGG   Helianthus annuus (common sunflower): 110903765Help
Entry
110903765         CDS       T05101                                 

Definition
(RefSeq) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00010  Glycolysis / Gluconeogenesis
han00020  Citrate cycle (TCA cycle)
han00620  Pyruvate metabolism
han00710  Carbon fixation in photosynthetic organisms
han01100  Metabolic pathways
han01110  Biosynthesis of secondary metabolites
han01200  Carbon metabolism
Module
han_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
han_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110903765
   00020 Citrate cycle (TCA cycle)
    110903765
   00620 Pyruvate metabolism
    110903765
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110903765
Enzymes [BR:han01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     110903765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_ATP AAA_24 AAA_33 AAA_16
Motif
Other DBs
NCBI-GeneID: 110903765
NCBI-ProteinID: XP_022005246
AA seq 661 aa AA seqDB search
MASNGNVSGVTPKSASAGRNGLPKITTHKKQNEICHDDSSAPVKAQTIDELHSLQRKKSA
PTTPLDGVQGAFANFAEEERHRQQLQSISASLASLTRETGPNLVKGDPTRKPETPRVQHA
PDHYVAQAFSASDSSLKSTHVLHNLSPAELYEQAIKYEQGSFITSTGALATLSGAKTGRS
PKDKRVVRDDVTEDELWWGKGSPNIEMDEHTFLVNRERAVDYLNSLEKVFVNDQFLNWDP
ENRIKVRIVSARAYHSLFMHNMCIRPSPEELESFGTPDFTIYNAGQFPCNRYTHYMTSST
SIDLNLGRREMVILGTQYAGEMKKGLFGVMHYLMPLRQILSLHSGCNMGKDGDVALFFGL
SGTGKTTLSTDHNRYLIGDDEHCWSDKGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGTV
LENVVFDEHTREVDYLDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLP
PVSKLSLAQTMYHFISGYTALVAGTEEGVKEPRATFSACFGAAFIMLHPTRYAAMLATKM
EKHGATGWLVNTGWSGGSYGSGSRMKLAYTRKIIDAIHSGSLLSANYKKTEVFGLEIPTE
VEGVPSEILDPVNTWSDKKAYKDTLLKLGGLFKNNFEVFVNHKIGKDDKLTEEILAAGPN
F
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaacggaaatgttagcggtgtgaccccaaaaagtgcaagtgcgggcaggaat
ggactgccgaagataacgacgcacaagaagcagaatgagatatgtcacgatgacagttct
gcgcctgtgaaggcgcagacgattgatgagttgcactctctccaaaggaagaaatcggca
ccaacaaccccgttggacggggttcaaggtgcgtttgctaatttcgctgaagaagaacgc
catagacaacaactccagtccatcagtgcatcgttggcgtcgctgacacgagaaaccggg
ccgaatttggtaaaaggagacccgacccgaaaacccgaaactcctcgggtgcaacacgcc
ccggaccactatgtcgcccaggcattctctgctagtgatagttctctcaaatctacccat
gtcctccacaatctctcccctgcagagctatatgagcaggctattaaatatgaacaaggg
tcgttcataacatcaaccggtgcattggcaaccttatctggtgctaaaactggacgatct
ccaaaggataagcgtgtcgttagagacgacgtcacggaagatgagctttggtggggcaag
ggttcaccgaatattgagatggatgagcatactttcttggtgaatagagaaagagcagtt
gattatttgaattctttggaaaaggtgtttgttaatgatcagttcttgaactgggacccg
gagaaccgaatcaaagttcgaatcgtgtctgccagagcttaccactctttgttcatgcac
aacatgtgcatccgacccagccctgaagaactggagagtttcggtactccagacttcaca
atctacaacgctgggcagtttccatgtaatcgatacacacactatatgacatcctccact
agcatagatttaaatctcggtagaagagaaatggtcatccttggcacacaatatgccggg
gaaatgaagaaaggtctcttcggtgtcatgcattatctcatgcctttacgtcaaatcctg
tcccttcattccggatgcaatatgggcaaagatggagatgttgccctcttcttcggtctc
tcaggtaccgggaaaacaaccttgtctactgatcacaaccggtatttgattggagacgat
gaacattgctggagtgacaagggtgtgtctaacatcgagggcggttgttatgcaaagtgt
atcgatctttcgagggagaaagaacctgatatctggaatgccattaaattcgggaccgtg
cttgaaaatgttgtatttgatgagcatactagagaggtggattatctagacaaatctgtc
acagagaatacgcgtgcagcataccccatcgagtacatccccaacgctaagatcccgtgt
gtgggtccacacccgaagaatgttatacttttggcatgtgatgcatttggtgtgcttccg
ccagtgagcaaactaagccttgctcagaccatgtatcacttcatcagtggctacaccgca
ctggtggctggcactgaggagggtgtaaaggagccacgtgcgacattttcagcctgcttt
ggtgcagcattcatcatgctacaccccacaagatatgcagcaatgcttgcaaccaaaatg
gagaaacacggtgctaccggatggctcgttaacactggctggtcaggtggcagctatggg
tctgggagtcgtatgaagctggcatacactcgcaaaatcatagacgctattcattctggt
agccttttgagtgcaaactacaagaaaaccgaagtgtttgggctggagattccaactgag
gttgagggtgtgccttctgagattcttgatccggtgaatacttggtcggacaagaaggct
tataaggacacactgttgaagttgggtgggctgttcaagaacaactttgaagtgtttgtg
aaccataagattggaaaggatgataagctgactgaggaaattcttgcggctggtcccaac
ttttaa

DBGET integrated database retrieval system