KEGG   Helianthus annuus (common sunflower): 110904242Help
Entry
110904242         CDS       T05101                                 

Definition
(RefSeq) glucomannan 4-beta-mannosyltransferase 9-like
  KO
K13680  beta-mannan synthase [EC:2.4.1.32]
Organism
han  Helianthus annuus (common sunflower)
Brite
KEGG Orthology (KO) [BR:han00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:han01003]
    110904242
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:han02000]
    110904242
Enzymes [BR:han01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.32  glucomannan 4-beta-mannosyltransferase
     110904242
Glycosyltransferases [BR:han01003]
 Polysaccharide
  Structural polysaccharide
   110904242
Transporters [BR:han02000]
 Other Transporters
  Others
   110904242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_tranf_2_3 Glyco_trans_2_3 Glycos_transf_2 Glyco_transf_21
Motif
Other DBs
NCBI-GeneID: 110904242
NCBI-ProteinID: XP_022005769
AA seq 531 aa AA seqDB search
MEKLSTMKLLPGLLVGAQYDIAGKIMLIWGQIRVSLVVPFLRIFMYINLVMLIMLFTEKV
YMAIVVAFNKLFGKTPEKRYKFEPFEDDIELGSSFYPLVLVQVPMFNEKEVYHLSIGAAC
GLSWPSDRIVIQVLDDSTDPLIKGMVEMECQSWASKGINIHYQVRENRKGYKAGNLKQGL
KHDYAKQCEYVVIFDADFQPEPEFLTQTIPFLHHNRQLGLVQARWKFVNSNDCLMTRMQE
MSLDYHFKVEQESGSINYAFFGFNGTAGVWRMAAIDEAGGWKDRTTVEDMDLAVRASLKG
WKFLYIGSLMVKSELPSVLKAYRYQQHRWSCGPANLFRKMVFEIIRNKKVTWRKKLYVVY
SFFFVRKIIAHFVTFTLYCVVIPATVFIPEVVIPSWGIIYIPTIITLLNAVGTPRSFYLV
VFWIVFDNVMSLHRTKATFIGLFETQRVNEWIVTEKHGNTSKVKTATQQSQSRFKISERI
LMLELCVGIVLFGCACYDFAYGKYHYFIYLYLQSIAFITMGCGYFGPQANS
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggagaagctttcgacgatgaaacttcttcctggattgttggtgggtgcacagtacgac
attgctgggaaaattatgttgatctggggtcagatcagggtgtcactagtggtgccattt
ctgagaatatttatgtatattaatctggtgatgttgataatgttgttcacagaaaaggtt
tacatggctatcgtggttgcatttaacaaactgtttggcaaaacaccagaaaaacgttac
aaatttgaaccatttgaagatgatattgagctgggtagctctttttaccctcttgttctt
gttcaagttccaatgttcaatgaaaaagaggtctatcatctttctattggagctgcatgt
gggctttcatggccgtctgatcgcattgtgattcaagtgcttgatgattcaacggatcca
ttgatcaagggtatggtggaaatggagtgccaaagttgggcaagcaaaggaataaacata
cactaccaagttagggaaaatcgaaagggatacaaagccgggaatcttaaacaagggcta
aagcatgattatgccaaacaatgcgagtacgtggttatctttgatgctgatttccaaccc
gaacctgagtttctcactcaaaccatcccattccttcatcataaccgtcaacttggtctt
gttcaagctcgttggaaattcgtgaactcaaatgattgtttaatgacaagaatgcaagag
atgtcacttgactaccatttcaaagtggagcaagaatctggttctattaattatgcattt
tttggattcaatgggactgccggagtttggcggatggctgcaattgatgaggcagggggg
tggaaggaccgcaccacagtagaagatatggatttggcagtccgagctagtcttaaagga
tggaagttcttatacattggttcactaatggttaaaagtgaactaccaagtgtgttaaaa
gcttatcgttatcagcagcaccgttggtcttgtgggccagctaacctttttagaaaaatg
gtttttgagatcattagaaacaaaaaagtgacatggcggaagaagctatatgtggtgtat
agtttcttctttgtaagaaagatcatagctcattttgtcacattcacactatattgtgtt
gtgattccagcaactgtatttataccggaagtcgtgattccaagttggggtataatatac
atcccaaccataatcactcttctaaatgcagttggaactcccaggtcattctatttggtg
gtgttttggattgtctttgataatgtcatgtccctccatcgaactaaggccacattcatt
ggacttttcgagactcaaagagtgaatgaatggatcgttaccgagaaacatggaaataca
tccaaggttaaaacggcaacacaacaaagtcaatctcggtttaaaataagtgaaagaatt
cttatgttggagctttgcgtggggattgttctctttggatgtgcttgctacgattttgca
tatgggaagtaccactacttcatttacctttatctacaatctatagcctttataacaatg
ggttgtggttattttggacctcaagctaactcttag

DBGET integrated database retrieval system