KEGG   Helianthus annuus (common sunflower): 110907643Help
Entry
110907643         CDS       T05101                                 

Definition
(RefSeq) putative serine/threonine-protein kinase
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
han  Helianthus annuus (common sunflower)
Brite
KEGG Orthology (KO) [BR:han00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:han01001]
    110907643
Enzymes [BR:han01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110907643
Protein kinases [BR:han01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110907643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase EF-hand_1 EF-hand_5 EF-hand_8 EF-hand_7 EF-hand_6 APH SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 110907643
NCBI-ProteinID: XP_022008283
AA seq 422 aa AA seqDB search
MLRLKKSKHLKKVSLAEIREATQSFASENCIGKGGYGMVYKGYLSIAPDSRTSILVAIKR
LNEKQGRQGSPEFLTEIHLLSGKKHPNLINLFGYCVEHNEKILIYEYAERGSLDMFLKDD
NRTHNLTWLERLKICVGAARGLHYLHNHVGKHEAIIHRDIKSANILIDENWVAKVSDFGL
STLLAGSDRDEVVSQACGTLGYVEPEYAKTDIVTKESDVYSFGIVLFEVLCGRLCTRIKI
NGGFLSPPSSAKDYYLNNSLDEIVDPSLREAMNFNSMDTFVEIAKECLHDDREERPPMGR
VVEELEKSFNLQIRSEKVKIIFQHFDLNKDGGLNKEELGALIVATNSGLKRSTDDRVYHM
VRSDQEKGLTCEGLLQIYDNCDVDLDMDYEVLSLKVNLHNGKKPSFTAWERYEKVFENFP
AF
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgttacgactcaaaaagtcgaaacacctcaaaaaagtatcattggcagagattcgagaa
gcaacccaaagcttcgcatcagaaaattgtataggtaaaggtggatatggtatggtgtac
aaagggtatctcagcattgctcctgactctcgaacatctatcctagtcgcaataaagagg
ttaaatgaaaagcagggacgacaagggtcaccggaatttttgacagagattcacttgctc
tccggtaaaaagcatccaaacttgatcaatctttttggttattgtgtagagcataacgag
aaaatcctcatatacgaatacgctgagcgtggaagcttggacatgtttctaaaggatgac
aatagaactcataatcttacgtggttggaaagactcaaaatttgtgttggtgctgcacgt
gggttacattacctgcataatcatgttggaaagcatgaagccataatccatcgagacata
aagagcgctaacatcttgattgacgagaattgggttgcaaaagtttctgattttggattg
tccacgttattggcaggttcagatagagatgaggttgtttctcaggcttgtggcacactg
ggttatgtcgaacctgaatatgctaaaactgatatagtgacgaaagagtctgacgtatac
tcttttggcatagtactgtttgaagttctatgtgggaggctgtgcaccaggattaaaatc
aatggtggcttcttgtcaccaccctcttcggccaaagattactacttgaataacagcttg
gatgagattgttgatcctagtttaagggaagctatgaacttcaactccatggacacattt
gtagaaattgccaaggaatgcttgcatgatgatcgagaagagaggccaccaatgggccgt
gtggtagaagagcttgaaaaatcattcaaccttcaaatcagatcagagaaagtgaagatt
atttttcagcattttgatttgaataaagacggtggtcttaacaaagaagaactaggagcc
cttattgttgctacaaactctggtcttaaacgctctactgacgacagggtgtaccatatg
gtcagatcagatcaggagaaaggtcttacctgtgaaggtcttttacaaatctatgacaac
tgtgatgttgacttagacatggattatgaggtgctaagccttaaagtgaacctccacaat
ggtaaaaaacctagtttcaccgcatgggagagatatgagaaggtgtttgaaaattttcca
gcgttttga

DBGET integrated database retrieval system