KEGG   Helianthus annuus (common sunflower): 110912414Help
Entry
110912414         CDS       T05101                                 

Definition
(RefSeq) calcium/calmodulin-regulated receptor-like kinase 2
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
han  Helianthus annuus (common sunflower)
Brite
KEGG Orthology (KO) [BR:han00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:han01001]
    110912414
Enzymes [BR:han01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110912414
Protein kinases [BR:han01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110912414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase ABC1 SKG6
Motif
Other DBs
NCBI-GeneID: 110912414
NCBI-ProteinID: XP_022012795
AA seq 421 aa AA seqDB search
MVQKADLVIIGVCVGVAVGIFLASLAFFGIRWYKRRAHLRKCAIDHGASTLPIRQNGVDT
SNVLSESFPNSVTVKVVTYPAKTSPLSKWNKNNKEQLVSASGLPRYSYKDIQKATKNFTT
ILGQGSFGPVYKATMPAGEVVAVKALAADSKQGETEFQTEVSLLGRLHHRNLVNLVGYCV
DKGQRMLIYEYMSNGSLASFLYSEEKRALNWQERLQIALDISHGIEYLHDGAVPPVIHRD
LKSANILLDHLVRAKVADFGLSKEEVFDGRNSGLKGTYGYIDPVYISTNKFTMKSDIYSF
GIILFELITAIHPQQNLIEYVNLAAMSSDGIDEILDKELVGEYDPEDVRSLARIANRCLH
KTPRKRPSIGEVSQAIARLKQRRLVREDSTMSFASEEFSEVVGRIELQQNQLKKMTSIAE
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaaaagctgatttggtgatcatcggagtgtgtgttggtgtggcggttggcatt
tttctagcgtcacttgcattctttggcattagatggtacaaaaggcgtgctcatctcaga
aagtgtgcgattgatcacggtgcatcaactcttcctatacgccaaaatggtgtagacaca
agtaacgtcttgagtgaatcttttccaaactccgttactgttaaagttgtaacctatcct
gcaaaaacttccccgctctctaaatggaacaaaaacaacaaagaacagttagtttcagcc
tctggtttgccaagatattcttacaaggacatacaaaaagctaccaaaaactttacgacc
attttgggacaagggtcttttggtccagtatacaaagcaacgatgcctgctggtgaagtc
gttgctgtgaaggctcttgctgctgactccaaacaaggggagacagaatttcaaaccgag
gtatctcttctgggaaggttgcaccacagaaacctggtaaatctagtcggatattgtgta
gataaaggacaacgcatgttaatatatgaatacatgagtaacggaagcctcgcaagtttt
ctatatagtgaagaaaaacgagcattgaattggcaagaaagacttcaaattgccctcgat
atatcacatggaatagagtatcttcatgatggggcggttccacctgtcatacatcgagac
ttgaagtctgcaaatatattgctagaccacttagtgagagccaaggttgctgattttggt
ctatcgaaagaagaggtttttgatggtagaaattcaggccttaaaggcacatacgggtac
atcgatcctgtatatatatccacaaacaagttcacaatgaaaagtgacatctacagtttt
gggatcatcttatttgaactcattaccgccattcacccacaacaaaatctcatagaatat
gtcaatctagcagctatgagctcagatgggatcgatgagattctcgacaaggagcttgtc
ggtgagtatgatcctgaagatgtaagaagcttggcacgaatagcaaacagatgcttgcat
aagacgccaagaaaacggccttcgattggggaggtttcacaggctatagcgaggctaaaa
caaaggcggttggttagggaagatagtacaatgtcgtttgcgagtgaagagttctcggag
gttgttgggcgcattgagttacagcaaaatcagttgaaaaagatgacaagcattgctgaa
tcttga

DBGET integrated database retrieval system