KEGG   Helianthus annuus (common sunflower): 110913264Help
Entry
110913264         CDS       T05101                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH11, chloroplastic-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:han00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110913264
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:han03041]
    110913264
Enzymes [BR:han01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     110913264
Spliceosome [BR:han03041]
 Complex C
  Other components
   Step II factors
    110913264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C IBR OB_NTP_bind HA2 zf-C3HC4_2 DEAD zf-C3HC4 AAA_22 zf-RING_2 AAA_19 zf-RING_UBOX AAA_29 ABC_tran AAA_30
Motif
Other DBs
NCBI-GeneID: 110913264
NCBI-ProteinID: XP_022013802
AA seq 1744 aa AA seqDB search
MSSDQVVPMHQNRAPVPANHRPFHHRRRDRSPPSSRTFATAHRRPNFIIELRSQSNDQNS
YNRHEIVTLMGKFKSAPDDFFLYQTGVVAARFFYQQWTTVLQTLVYLWEVLLDGGLSFMP
RLVQNVLVPSDTEELNSRLRVLFREKILSLLEGELVKKMGNKLEEVSREIARLGLLLKKP
KRPVMHMELWKKREGNVREKELIERRIGEFKSAMGCILDYLDGKVFDGSDVKVLLLKGGF
DWNKIYWMIKRECRRLDDGLPIYADRMDILWKIHCQQVMVLIGETGSGKSTQLVQFLVDS
GVAGDKSIVCTQPRKLAAISLANRVKEESRGCCDDNSIICSSTYSSFDRLDSKVIYLTDH
CLLQHYMNDKNFSWASCIIVDEAHERSLSTDLLLALIKDLLHRRSDLRFIIMSATADAEQ
LSKYYFDCDTHHVAGRTFPVDIRYVPALSSSSSNVHHDFVAPYVSEVLKRVGEIHRTEDQ
GTILAFLTSQMEVEWACDQFKGPSIVSLPLHGKLSHEEQYRVYLNYPNKRKVIFSTNLAE
TSLTIPGVKYVVDSGMVKESRFEPGTGMNVLKVCRISQSSANQRAGRAGRTEPGKCYRIY
EEREFQSMPCHQEPEIRRVNLGIAVLRILALGIHKVEEFDFIDAPCNTAIETAIKNLIQL
GAIVLEHGIHKLTKDGRMLVKLGIEPRLGKMILKCFENRMGREGLVLAAVMANSSSIFCR
VGKDEEKQKSDCLKVQFCHTGGDLFTLLSVYRKWESIPRDKRNQWCWDNSINAKSMRRCQ
ETVQEMESCLQHELNIIIPTYWRWDPMVKTEYDQILKDVILSALADNIAMYSGNDNLGYE
VPSTGTHVQLHPSCSLLMFGERPSWVVFGEIIAMPNQYLVCVTSVDFESLLTLSPAPFDI
SQIDRRKLQLKVLTGFGTTLLKRFCGKSNSSLRHLVSNIKDTINDDRVRLEVSVDHNEVN
VFATSEHLTRVCEIVNSVLEREGRWLQNECLEKCLFPDRHVSPPVALFGSGAEIKHLELE
KRCLTVDIFVHGSHDIEEKELLSFLEQHTSGNICAVHKLNLVGQDNEKWGRVTFFTPEAA
EKATKLSPVDFNNCKLKIAPSRSIFGGDNKFSSFPAVKAKVAWPRRRNRGFAFVQCNPQD
VSAMVEDFSNVLIGDQFINCRPSMKFTDSIMLSGIDGDVFEPELYDALYRATNRKILKVT
LPRAAAVENPPLVVLEDALLREVRSFMPAGNSKNECVRVHIFPYEAFDNYVKAEISFDGS
LHLEAAKALEQIDGKSLSGCQPWQKIKCQQQFNSIVSCPASVYGVIKEQLQALLKNLENR
KGAEFFPDWNENGTYRIRISAKATKIMAESRRPLEQLMNGRTIIDDQLTPPVIQLIFSRE
GFALQRSIQRETGTFFLFDRHNHSFRVFGPLNKLDLAQNKLVQSLVTLHENKQLDVHLRG
PAFPPDLMKKVVEKFGPDLHGLKERFPGSDFMLNTRHHIISVRGTKELKQNVEETVHEIV
RTTTSTSGQTVISQTRSCPICLCDVEDGYRLEKCNHEFCRPCLVEQLESAIKNPGNSFPI
RCAQEGCRELILVVDIKSLLLTDKPLNSIREETGDKLERLGSKVDELFRASLGSFVASSS
GKYRFCPSPDCPSVYQVQDDGRPFACGACSVETCTRCHLEYHPFLSCEMYKEFKRDPDLS
LKEWMKGKEAVRHCPVCNFTIEKIDGCNHIECRCGIHICWVCLETFKSSDECYGHLRSIH
HAIV
NT seq 5235 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgatcaagttgttccgatgcaccagaacagagctccggttccggcgaaccac
cggccgtttcaccaccggcgccgagatcgatctccgccgtcctccagaaccttcgccacc
gctcaccgccgccctaatttcatcatcgaactccgttcgcaaagtaacgatcagaattcg
tacaatcgccatgaaattgttactctcatggggaaatttaagtccgctcctgatgacttt
tttctctaccaaacaggtgtggttgctgctaggtttttctaccagcagtggactacggtg
ctgcagacgcttgtgtatctgtgggaggttttattagacggaggtttgtcgtttatgccg
cgccttgtacagaatgtgctggtgccttccgatacagaggagttaaattctcggcttagg
gttttgttcagggagaagatattaagccttttggaaggagaattggtgaagaaaatgggg
aataagttggaggaagtgtcgcgggagattgcgaggttaggtttgttgttaaagaagccg
aagaggccggtgatgcatatggagttatggaaaaagagggaagggaatgtgcgtgagaaa
gagttgattgagaggaggattggagagtttaaatctgcgatgggatgtatactcgattat
ctcgatgggaaggtgtttgatggttcggatgttaaggtgttgttgttgaaaggaggtttt
gattggaacaagatttattggatgattaagagggagtgtcgacggcttgatgatggtttg
ccgatttatgctgatcgtatggatatcctttggaagatacactgtcagcaggtaatggtg
ttgatcggagaaaccggttcgggaaaaagcacccagctggttcagttccttgttgattct
ggagtggcaggtgacaagtcgatagtttgcacgcagccacgtaagcttgctgccatatca
ttagcaaatagagttaaagaagaaagtcgtgggtgttgtgacgataattcaatcatttgt
tcatcaacctattcatcttttgaccggttggattctaaggtgatatacttaaccgaccac
tgcctacttcagcactacatgaacgacaagaacttttcttgggcatcgtgcatcatcgtt
gacgaggcacatgaaagaagcttgtcaaccgatcttcttttagcgttaataaaagatcta
ctccaccggcggtctgatctacggtttatcataatgtctgcaaccgccgacgcagaacaa
ctctctaaatattatttcgattgcgatacgcatcatgtggcgggcagaactttccctgtt
gatattcgatacgttcccgcattatcatcatcatcatctaatgttcaccatgactttgtg
gccccatatgtttccgaagtgttaaaaagggtcggtgagatccatcgaacggaggatcaa
gggacgattcttgcgtttctcacttctcaaatggaggtagaatgggcctgtgatcagttt
aaagggccatcgatagtttcattacctttgcatggaaagttatctcacgaagaacaatac
cgtgtgtatctgaattatcccaacaagcgaaaagtcatattctcgaccaatcttgctgag
acatcattgactattccaggagtcaaatatgttgttgactctggtatggtcaaagagagt
cggtttgaacccgggactgggatgaacgttcttaaagtttgtaggatcagtcaaagttcg
gctaaccaacgcgcgggtcgtgctggcagaacggaacccggaaagtgttatcggatttac
gaagagagagaatttcagtccatgccttgtcatcaagaacccgaaatccgtagggttaat
ctcggaattgcggttctcagaattctcgctcttgggattcataaagttgaggagtttgat
tttatcgacgcgccatgcaatacagctatcgagactgcgatcaagaatctgatccaattg
ggagccatcgtactcgaacacggtatccataagttaacgaaagacggtcggatgttggtg
aaattaggaatcgagccgaggctcggtaaaatgattctgaagtgctttgaaaaccgtatg
ggcagggaaggactcgttcttgctgcggttatggctaattccagcagcatattttgcaga
gtcggtaaagatgaagaaaaacaaaaatcagattgtttaaaagtacaattctgccataca
ggtggtgatttatttactttattatctgtttacagaaaatgggaatctattcctcgtgat
aagaggaatcaatggtgttgggataatagcattaacgcaaaatctatgcgaagatgccaa
gaaactgtgcaggaaatggaaagttgtcttcagcacgagctcaatatcattattccgact
tattggcgatgggatcccatggtgaaaaccgaatacgatcaaattcttaaagatgtcata
ctttcggctctagcagataacatagcaatgtattcgggaaacgataatcttggttatgaa
gtaccgtcaactggaacgcatgttcagttgcatccttcgtgttcgttactgatgttcggc
gagagaccaagttgggtggtttttggggaaattatcgcaatgccgaatcagtacttggtt
tgtgtaacttctgttgacttcgaatctttgctgactctttcccctgctccatttgatatt
tcgcagattgaccgtcggaaactgcaactaaaggtgttaacgggtttcggaacaacatta
ctgaaaagattttgcgggaagtcaaattctagtctgagacatcttgtttcaaacatcaag
gataccattaacgatgacagagttcgtcttgaagtttccgttgaccacaatgaagtcaac
gtatttgcgacttccgaacacctaacacgggtgtgtgagattgtaaactcggtattggag
cgggaaggaaggtggttacaaaatgaatgcctggaaaaatgtctgtttcccgacagacac
gtgtcccctcctgtagctctgttcggttcgggtgccgagataaagcatctggaactcgaa
aaacgatgtcttacagttgatatattcgttcatggctcacacgatatcgaggagaaagag
ctgctttcgtttttggaacaacacacatccggcaacatctgtgctgttcataagcttaat
ttagtcggtcaagataacgaaaagtggggccgggtaacgtttttcactcccgaagccgct
gagaaagctacaaagttgagtccagttgacttcaataactgtaaactgaaaatcgctccg
tcaagaagcatatttggaggcgataacaagttctcgtcttttccagctgtgaaagcgaaa
gtagcatggccccgtaggcgtaaccgaggttttgcgtttgttcaatgtaatccgcaagac
gtatcagccatggttgaagatttttcgaacgtgttaatcggcgaccagtttataaactgt
aggccgagcatgaagtttaccgacagtattatgctgtcgggaattgacggggatgtcttc
gaacccgaactttatgatgcattatacagagcaaccaatcgaaaaattctgaaagttacc
ctaccacgggctgcagctgtagagaatccgccccttgtggttctggaagatgcgcttttg
agagaggtgagatcgttcatgccagcagggaattcgaagaacgaatgtgttcgtgttcat
attttcccatatgaagcgtttgataattacgtgaaagcagagattagtttcgatggaagt
ttacatttggaggctgcgaaagcgttggagcagattgacgggaaatcgttgtcgggttgt
cagccatggcagaagatcaaatgtcagcagcagtttaatagcattgtttcttgccctgct
tctgtgtatggcgttattaaagagcaactgcaagctttactcaaaaatcttgagaatcgg
aaaggagcggagttctttccggactggaacgagaacgggacataccgtatcaggatatct
gccaaggctacaaaaataatggccgaatcgagacgacctctggaacagcttatgaacgga
agaaccataattgatgatcagctcactccgcctgttatacaacttatcttttctcgtgaa
ggattcgctctgcagaggtccattcaacgcgaaaccggcacgtttttcctatttgacaga
cataatcatagctttcgagtcttcggcccgttaaacaagctcgatctagcccagaacaag
ctggttcagtcccttgtgaccctacacgagaacaaacagctcgatgttcatctcaggggt
cccgcttttccgcccgatttgatgaaaaaggtggttgaaaagtttgggcccgaccttcac
gggcttaaagaaagattcccgggatcagacttcatgttaaacacgcgccaccatatcatc
tccgttcgcggtactaaagaattgaaacaaaatgtcgaagaaacagtacacgagattgtt
cggaccacgacttctacttctggtcaaacggtcataagtcaaacgcgctcatgtcctatt
tgtctctgcgatgtcgaagatggctaccgcttggaaaagtgcaaccatgagttttgtcgg
ccgtgtttggtcgaacaattggaatctgcaatcaagaaccccgggaacagtttcccgatc
cgctgtgcgcaagagggttgcagggagttgatcttagtggtggacattaaatcacttctg
ttaactgataagcctcttaactccatcagggaggaaactggcgacaaactcgaaagatta
gggagcaaagtagatgagcttttccgggcttctctagggtcgtttgtggcatctagttca
gggaaataccgattttgcccttcaccggactgtccttcggtttaccaagtgcaagatgat
gggaggccgtttgcgtgtggcgcgtgttctgtggagacgtgtactcgatgccacctggaa
taccatccgtttttgtcgtgtgaaatgtacaaggagttcaagcgcgatccggacttgtcg
ttaaaggaatggatgaaggggaaagaggccgtgaggcattgtccggtttgtaactttacg
atagagaagatcgatgggtgcaaccatatcgagtgccggtgtggaattcacatctgttgg
gtttgtcttgaaacttttaagagcagtgatgagtgctatggacatttgaggtcaatacat
catgcaattgtttag

DBGET integrated database retrieval system