KEGG   Helianthus annuus (common sunflower): 110913353Help
Entry
110913353         CDS       T05101                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 15
Organism
han  Helianthus annuus (common sunflower)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Stress-antifung PRIMA1 TMEM154 Haspin_kinase EphA2_TM Pkinase_fungal Ly49 DUF3377 DUF4448 DAP10 APH
Motif
Other DBs
NCBI-GeneID: 110913353
NCBI-ProteinID: XP_022013881
AA seq 695 aa AA seqDB search
MVPKNSYFIFVLVIILNCITLCVSQDILSPIICDGNANFTINSTYQNNLDDALSSLTSDT
SIRYGFYNRSVGQTPDQANVIALCRGDVEPADCRGCINEASSRIRDTCPNQKGAVGWYID
TCMLRYCNVTILGTNPDTSRIRELINISNATNVDQFNQALNQLLDQLRTEASSGGSLRKY
ATNSTNGPGTTRIFGYMQCTPDLSENQCYSCLDSAADEVSRSSGCDSRPTEPTADAIDKG
RRGARVYYPSCTVRYESSRFLNDTVDLAPPSPPPTQSSPPPPPPPPSPSGSSSNTTIVVV
IAVVATLSLVILVVFFVCVFMRRKRKHEARQPDSLGDTAESLQYSFGIIKAATNDFSENN
KLGQGGFGLVYKGKLQNGQEIAVKRLSRDSGQGEQEFKNEVLLLARLQHRNLVRLLGFSL
QGSERLLMYEFVQNASLDKFIFDPTKRVVLDWERRYKILGGVAKGLLYLHEDSRLKIIHR
DLKASNILLDSQMIPKIADFGMARLFTPEETQANTSRIVGTYGYMAPEYAMHGQFSVKSD
VFSFGVLVLEIVTGQKNHTFQNGVVIEDLLSHAWKSWRDGTASSLIDPVLRDGSNSLRDM
IRCIHIGLLCVQEDLNERPTMASVVLMLSSLSLTLPVPSEPAFFVHTNTNTNPENPLFVE
YTSSTSHPNQLKSKSRSSQRSVASDISINDLTLNR
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggtacccaaaaactcatatttcatttttgtcttggtgatcatcctaaattgtatcacc
ctttgtgtgtctcaagatattctatcccctataatatgcgatggtaacgcgaatttcact
ataaatagtacgtaccaaaataatcttgatgacgctttgtcgtctttgacgtctgatacc
agcatcagatacgggttctacaaccggtctgttggtcaaacccctgatcaagccaatgtg
atcgcgctatgtagaggtgacgttgagccagctgactgtcgggggtgcataaatgaagct
agttcaagaatacgagatacttgcccaaaccaaaagggtgcagttggttggtatattgat
acatgtatgttaaggtactgtaatgtgaccattttgggaactaatccagacactagtcgt
atacgcgaattgattaacattagtaacgcgaccaacgtggaccagtttaaccaagcgctc
aaccagctgttggatcaacttagaactgaagcttcaagtggtggatcacttcgtaaatac
gcaacaaacagcacgaacggacctgggacgacaaggatctttgggtacatgcagtgtaca
ccggacttatcagaaaatcagtgttatagttgcttggatagtgcagctgatgaagtttcg
agatcatcaggttgcgactcgagaccaactgaaccaacagctgatgctattgataaaggt
cgccgtggagcaagggtttattatcctagttgcactgttagatatgaaagttcaaggttt
cttaatgatacggtagatcttgcaccaccatccccgccgccaacacagtcatccccacca
ccaccaccaccaccaccatcaccttcaggcagcagtagtaacactacaattgttgtagtc
atcgctgtcgttgcaacactaagtcttgtgatacttgtggtgtttttcgtttgtgtgttc
atgagaagaaaaagaaagcatgaagcacgtcaaccggacagcttaggtgatacagctgaa
tcgttgcaatatagcttcggtataatcaaagcagcaacaaatgatttctcagagaacaat
aagctcggtcaaggtggttttggtttggtttataagggtaagttacaaaacggacaagaa
atagcagtgaagaggttgtcgagggattcagggcaaggggaacaagaattcaagaatgag
gttttgttacttgcgaggctgcaacacaggaacttggttcggcttctaggatttagccta
caagggtccgaacgacttttgatgtatgagtttgtacaaaatgcaagtctagataaattt
atattcgatccaacaaagcgtgtggttcttgattgggaaagaagatacaaaattttagga
ggtgttgcgaagggccttttgtatctacacgaggattcacgactaaagataattcatcga
gacctaaaagctagtaacattttgttggattcccagatgattccgaaaatcgcagatttt
ggtatggcaaggttgttcacacccgaagaaacccaagctaacactagtcgaatcgttgga
acatatggatacatggcacctgagtacgcaatgcacggtcaattttcagtaaaatcagac
gtgttcagttttggtgtattggtacttgaaattgtaactgggcagaagaaccacactttc
cagaacggggtggtgattgaagatcttcttagtcatgcatggaaaagctggagagatggg
acggcctcaagtttaatcgatcctgtattgagagacggatccaattccctacgtgatatg
attcgatgcatccacattggtctattatgtgttcaagaagatttaaatgagagaccaact
atggcttcagttgttctcatgcttagtagcttatctctaaccctcccggtcccttcagag
cctgccttttttgtgcacacgaacacaaacacgaatcctgaaaaccccttgtttgtagag
tacacttcaagtactagtcatcctaatcaattgaaaagtaaatcaagatcttcacaacgg
tctgtagcaagtgatatttctataaacgacctaactctcaatagatga

DBGET integrated database retrieval system