KEGG   Helianthus annuus (common sunflower): 110914413Help
Entry
110914413         CDS       T05101                                 

Definition
(RefSeq) beta-fructofuranosidase, soluble isoenzyme I-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00052  Galactose metabolism
han00500  Starch and sucrose metabolism
han01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:han00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    110914413
   00500 Starch and sucrose metabolism
    110914413
Enzymes [BR:han01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     110914413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 110914413
NCBI-ProteinID: XP_022014898
AA seq 625 aa AA seqDB search
MAFSFFTPFVTYNDLERWPKSTGIPTGRLSKVVAGLFVSILVLSSLTIVIHNQLLKPQGR
RQLAAVSTNLEIKIKPSSIGVLSQEKVVGSNVEFERSVYHFHPQKNFIGDPNGPLYHMGW
YHLFYQYNPDSAIWGNITWGHAVSKDLINWFQLPLAMVPDHWYDQKGVMTGSATILPDGR
IIMYYTGNAHDLSQLQCLAFAANSSDPLLVEWVKYKDNPILGPPLGVGRKDFRDPSSLWM
GPDGKYRMVMGSKHNNTIGCALIYHTTNFTHFELMDEVLHEVPHTGMWECVDLYPVSTTK
TDGLDMSSYESDAKYVLKQSGDEDRHDWYAIGSYDVVKDKWYPDDPEMDVGIGLRYDYGK
FYASKTFYDPSKRRRVLWGYVGETDLQNDDIKKGWANMLNVPRTVVLDPNTQSNLIQWPV
EEAETLRSKTYDEFKDVELAPGSLVPLNIDSTAQLDISASFEVDEALLDATLEADTIFNC
TTSDGSAMRGVLGPFGVVVLADEALSEQTPVYFYIAKNTDGTSRTYFCVDELRSTKLSGV
RNFVYGSTVPVLHGENYNMRLLVDHSIVESFAQGGRTVITSRVYPTKAIYDAAKVFLFNN
GTGITVKASLKIWKMGEAKLEPFHV
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggctttttccttcttcaccccttttgttacttacaatgaccttgaaaggtggccgaaa
tccactggaattccgactggtcgtttatcaaaagttgtcgctggtttatttgtatccatt
ctagtcctttcatcgttaactattgtaattcacaaccaactactaaaaccccaaggtcgt
cggcaattagctgccgtctcaactaatttggagatcaagatcaaaccatcatcgatagga
gtcctgtcacaagagaaggttgttggtagtaacgtagaattcgaaagatctgtttatcac
tttcatccccaaaagaattttattggtgaccctaatggtccattatatcacatgggttgg
taccatttattctaccaatacaacccagattcagcaatatggggaaatatcacttggggc
catgcagtctctaaagatctcatcaactggttccaactccctctagccatggtccccgac
cactggtacgaccaaaagggtgtcatgactggctccgccaccatcctcccggatggccga
atcataatgtactatacaggcaatgcccatgatctatctcagcttcagtgcctagctttc
gccgccaattcatccgatcccctccttgttgaatgggttaaatacaaagataaccccatt
cttggtcctcctctaggcgtcggtcgcaaagatttccgtgacccgtcatctctctggatg
gggccggacggaaagtatcgaatggttatggggtcgaagcataacaataccataggttgt
gccctaatttaccacaccaccaatttcactcattttgaattgatggatgaggtgctccat
gaagttccgcatacaggtatgtgggaatgcgtggatctttacccggtatccaccacaaag
acagacgggttggatatgtcgagttatgagtcggatgctaagtatgtgttgaagcaaagt
ggggacgaagataggcatgattggtatgcaatcggatcgtatgacgtggtgaaagataag
tggtatccagatgatccggaaatggatgtgggtatcgggttgagatatgattatggaaag
ttttatgcatcaaagacgttttacgacccgagtaagaggagacgggtattatggggctat
gttggagaaacggatcttcaaaatgatgatataaaaaaaggatgggcaaatatgttgaat
gttccaagaaccgtggtgttggacccgaatacacaaagtaacttgatccaatggcccgtc
gaggaagcagagacattaagatctaaaacgtacgatgaattcaaagatgtcgagttagcg
cccgggtcacttgttccgcttaatatagactcaactgcacagttggacataagtgcctca
tttgaggtagatgaagctttattggatgcaaccttagaagccgatactattttcaactgc
acaacgagcgacggttcagccatgaggggcgttttgggaccgttcggggtagtggttcta
gccgatgaagcactttcggaacaaactccagtttatttctacattgcaaagaacactgat
ggcacctcaagaacctatttctgtgttgatgaattaagatcaacaaagctctcaggtgtg
cgcaattttgtatatggaagcactgttccagtactccatggtgaaaactacaacatgagg
ttattggtggaccactcaatcgtagaaagctttgcacaaggaggaagaacggtgatcaca
tcaagagtgtatcctacaaaggccatatatgatgcagccaaagtgtttttgttcaacaat
ggcactggtatcactgttaaggcatctctcaagatatggaagatgggtgaagcaaaactt
gagccttttcacgtttaa

DBGET integrated database retrieval system