KEGG   Helianthus annuus (common sunflower): 110915291Help
Entry
110915291         CDS       T05101                                 

Definition
(RefSeq) acyl-protein thioesterase 2-like
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110915291
Enzymes [BR:han01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     110915291
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Hydrolase_4 FSH1 Abhydrolase_6 DLH LIP Peptidase_S9 Lipase_3
Motif
Other DBs
NCBI-GeneID: 110915291
NCBI-ProteinID: XP_022015658
AA seq 252 aa AA seqDB search
MSLSGPSGGRTGRRTLEFGKTYVVKPKGKHLATIVWLHGLGDNGSSWAQLLDTLPLPNIK
WICPTSPSQPLTLFGGFPSNAWFDVSDLSEDAKQDVEGLDSSAAHVLSLLSTEPADVKLG
VGGFSMGSALALYSAVSFANGKLGNGDSFSARLDAVVGLSGWLPCAKDLTNKVESDEAAA
RASSLPILLCHGKADDVVLFRYGDKSAEKLTSTGFQNLTFKTYDSLGHYTMPQEMDDVCS
WITSKLALKDEP
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcagtggcccttccggtggtagaactggaagaaggacacttgagttcggaaag
acatatgtggtaaaacctaaaggcaaacaccttgcaaccattgtgtggttgcatggcctt
ggtgacaatggctcgagttgggcccagcttttggatacccttcctcttccaaacatcaaa
tggatatgccctacttctccttctcaacccttgaccttatttggtggctttccgtcaaat
gcatggtttgatgtgagtgacctgtctgaagatgcaaaacaagacgtagagggtcttgat
tcttcagctgcacatgttttaagtctactctcgactgagcccgcagacgtcaaacttggt
gtaggaggcttcagtatgggttcagcacttgctttgtactctgcggtttcctttgctaat
ggaaaacttgggaatggcgattctttctcagcccgtttggatgcagttgtaggccttagt
ggctggcttccatgtgcaaaggatctaacgaacaaggtagaaagtgatgaagctgcagcc
cgagcatcgtccttgcctattttgctttgtcatggcaaagctgatgatgtggttctcttc
cgctacggtgacaagtcagctgagaaactaacttcgaccggcttccaaaacttgaccttc
aaaacttatgactcgctcggccactacacaatgcctcaagagatggacgacgtttgttcg
tggataacttcaaaattagcgctcaaggacgagccataa

DBGET integrated database retrieval system