KEGG   Helianthus annuus (common sunflower): 110917014Help
Entry
110917014         CDS       T05101                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 8
Organism
han  Helianthus annuus (common sunflower)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Stress-antifung APH Haspin_kinase Pkinase_fungal Shisa DUF4083 NS3_envE
Motif
Other DBs
NCBI-GeneID: 110917014
NCBI-ProteinID: XP_022017328
AA seq 396 aa AA seqDB search
MDRLRGEAAAGGPLLKFATGNITGPDFLTIHGLVQCTPNLSEQVCSDCLEAAVNQIPNSS
INGTNGGRILQSTCNFRFEVYDFFNQTTPGIPQPSSPGKEEHTTLIVIIVIVFVTIAAII
IASLCFFMRTMKKKTQISSPHESTQTETMDIGIAEPLQYSFSAIKAATNDFSEDNKLGRG
GFGAVYKGTLIDGNEIAVKRLARNSQQGDVEFKNEVFLVLKLQHRNLVRLLGYSIEGKER
LLIYEFLPNGSLNQFIFDQTKRILLDWEMRYNIILGIAKGLLYLHEDSRLTIIHRDMKAS
NVLLDAEMNPKIADFGLARLFKPEETQGDTSRIVGTYGYMAPEYVRHGHFSNKSDVFSFG
VLVLEIVTGQENKCFQHGESLENLLSFVSIISFHQT
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggatcggttgagaggtgaggcggctgctggcggcccgttactgaagtttgcgaccggg
aacataaccgggccagatttcctaacgatccatggtcttgtgcagtgtactccaaacttg
tcggagcaagtgtgtagtgattgtttggaggctgcagtaaatcagatcccaaattctagt
attaatgggacaaatggcgggagaattcttcaatcgacgtgtaattttaggtttgaggta
tatgattttttcaatcagactactccgggaattccacaaccatcatcaccaggtaaagag
gaacacacaactcttattgtgataatagtaattgtttttgtgacaattgcggccatcata
attgcttcattgtgtttctttatgaggaccatgaagaagaaaacacaaatttcgtcacct
catgaaagtactcagactgaaactatggacattggcattgctgaaccattacaatacagc
tttagtgcaatcaaagcagcaactaatgacttttccgaagacaataagcttggacgaggt
ggattcggtgcagtttacaagggtacccttatagacgggaatgaaatagcagttaagaga
ctagcaaggaattcacaacaaggtgatgttgaattcaagaatgaggttttcctagttttg
aagcttcaacatcgtaatttggttaggctccttggttacagcatagaaggaaaggaaaga
cttcttatttatgagttcttgccaaatggaagccttaatcagtttatatttgaccaaact
aaacgtatacttcttgattgggaaatgcggtacaatataatattgggcatagcgaaggga
ttgttataccttcatgaagattctcgtctaacaataattcatcgtgatatgaaggcaagt
aatgttcttctagatgcagaaatgaaccctaaaattgctgactttggtttggcaagatta
tttaaacctgaggaaacccaaggagacacgagtcggattgttggaacatatggttatatg
gcacctgaatatgtccgacatggccatttctcaaacaagtcagatgtctttagcttcgga
gtgttggtactagagatagtaacgggtcaagaaaacaaatgttttcagcatggagagagt
ttagaaaatcttcttagctttgtaagtatcatatcatttcaccaaacctga

DBGET integrated database retrieval system