KEGG   Helianthus annuus (common sunflower): 110918028Help
Entry
110918028         CDS       T05101                                 

Definition
(RefSeq) ent-kaur-16-ene synthase, chloroplastic-like isoform X1
  KO
K04121  ent-kaurene synthase [EC:4.2.3.19]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00904  Diterpenoid biosynthesis
han01100  Metabolic pathways
han01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    110918028
Enzymes [BR:han01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.19  ent-kaurene synthase
     110918028
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth Prenyltrans
Motif
Other DBs
NCBI-GeneID: 110918028
NCBI-ProteinID: XP_022018113
AA seq 774 aa AA seqDB search
MNITITQSMNGPLSTKPYRSWALSAIHTAPSHVGQANPTNLAIDTTKERIRKLFNNVDLS
VSSYDTAWVAMVPSPSSPKSPCFPECLNWLVDNQLDDGSWGLVNHIRTHPLLKDSLSSTL
ACIVALKRWNVGEDQINKGLRFIESNLASATDKSQPSPFGFDIIFPGMLEYAQQLNINLR
SKQTDFTLMLHERDLELKRCHSNEMEAYLAYISEGLGNLYDWHMVKKYQLKNGSVFNSPS
ATAAAFINHQDTGCLNYLNSLLDKFGNAVPTVYPLDLYIRLSMVDTLERLGIARHFSVEV
KNVLDETYRCWVERDEQIFMDVVTCALAFRLLRINGYEVSSDPLAEITNEGAFKDEYAAL
EVYNASQVLYPEDLSFGEQILRSGDILRRIISTDSNRLSKFIHKEVENALKFPFNTGLER
INTRRNIDRYNVDDTRILKTTYRSSNISNKDYLRFAVEDYNSCQSIYREELKGLERWVVD
NKLDQLKFARQKTAYCYFSVAATLSSPELSDARISWAKNGILTTVVDDFFDVGGTIDELA
NLIQCVEKWNVDVDNDCCSEQVRIVFLALKDAICWIGDTAFKWQERDVTSHVIQTWLDLM
NSMLREAIWTRDAYVPTINEYMENAYVSFALGPIVLPAIYFVGPKLSEEIVESSEYHYLY
ELMSTLGRLLNDIHSFKREYKEGKLNAVALQLSNEESGNVEEEVVKEMMTMIKNKRREMM
KLVTEEKGSIVPRACKDAFWNMCNVLNLFYAKDDGFTGDTILGIVKDVIYEPLS
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgaacattacaattacacaaagcatgaatggccctttgtcaaccaaaccttatcgatca
tgggctctgtcagctattcatacagcaccttctcatgttggacaagctaatcccaccaat
ctggccattgatacaaccaaagaaagaatccgtaaactgttcaacaatgtggacctttcg
gtttcttcatacgacacagcctgggtagccatggtcccttctccaagctcacccaaatcc
ccttgtttcccagagtgtcttaactggttagttgataaccagctcgatgatggttcatgg
ggtctcgttaatcacattcgtactcatccgttacttaaagattccctctcttcaacgtta
gcatgtattgttgcattaaaacgatggaatgttggggaagaccaaattaataaaggtcta
cgttttatcgagtcgaatcttgcttcagctacggacaaaagtcaaccatctccctttggt
tttgacatcatatttcctggtatgctggagtatgcgcaacagttgaacataaacctacgt
tcaaaacagacagattttactttaatgctacatgagagagatttggagctaaaaagatgt
cattcgaatgagatggaagcatacctggcgtatatttcagaaggactcggtaacttatat
gattggcatatggtgaagaaatatcagctgaaaaatggttcggttttcaactcaccgtca
gcaacagcagctgcttttattaatcatcaagatactggttgtcttaattatctaaattca
cttttggacaagtttggtaatgcagtcccgacagtttatcctcttgatttatatatccgg
ctttccatggttgatacgcttgaaagattaggaatcgcacgccatttcagcgtggaagtt
aaaaatgttttagacgaaacatacagatgttgggtggagcgagatgagcaaatatttatg
gatgttgtaacttgtgctttagcctttcggttattaaggatcaacgggtatgaagtatcc
tcagatccattggctgaaattactaacgaaggagctttcaaagacgaatatgcagctctt
gaagtgtataatgcatcacaggttttatacccagaggatttatctttcggagaacaaatc
ttgaggtcgggtgatattcttagaaggataatatccactgattcaaaccggctctctaaa
tttattcataaagaggtggagaatgctcttaagttcccattcaataccggtttagaacgc
ataaacactagacgaaatatagatcgctacaatgttgatgatacaagaattttgaaaact
acatatcgatcatcgaatattagcaacaaggattacttaaggttcgcagttgaagattat
aactcttgccaatctatttaccgtgaagaattaaaaggtcttgaaaggtgggtggtagat
aacaaattggaccagctcaagtttgctaggcaaaagacagcctactgttacttctctgtt
gccgcaacactttcatctcctgaattatcggacgcgcgtatttcatgggccaaaaacggt
atccttactacagtagttgatgacttttttgacgttggtggtactatcgacgaattggcc
aatctgattcagtgtgttgaaaaatggaatgtagacgttgacaatgattgctgttcggag
caagttcgaattgtatttttagcattaaaagatgcaatctgttggattggagacacagct
ttcaaatggcaagaacgagatgtaacaagccatgttattcaaacttggttggatctcatg
aatagtatgttgagggaagctatatggacaagagacgcgtatgtaccaacaataaatgaa
tatatggaaaatgcttacgtgtcgtttgcattaggacctattgtactgcccgctatttac
tttgtggggcccaagttgtcggaggagattgtcgaaagctccgagtatcattatctatac
gagctaatgagcactttgggccggcttctgaatgatatacatagcttcaagagagaatat
aaggaaggaaaactaaatgctgtagcgttgcaactgagtaatgaggaaagtgggaatgtg
gaagaagaggtggtaaaggagatgatgacgatgataaagaacaagaggagagagatgatg
aagttagttacggaagaaaagggaagcattgttcctagagcttgtaaggacgcgttttgg
aacatgtgtaacgtgttgaatcttttttatgcgaaggatgatgggtttactggagacaca
attcttggtattgtgaaggacgtcatttacgagccgttgagttga

DBGET integrated database retrieval system