KEGG   Helianthus annuus (common sunflower): 110920710Help
Entry
110920710         CDS       T05101                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 15
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
han  Helianthus annuus (common sunflower)
Brite
KEGG Orthology (KO) [BR:han00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:han01001]
    110920710
Enzymes [BR:han01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110920710
Protein kinases [BR:han01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110920710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Stress-antifung Haspin_kinase Orf78 Shisa Pkinase_fungal ECSCR APH Tmemb_9 EphA2_TM Comm
Motif
Other DBs
NCBI-GeneID: 110920710
NCBI-ProteinID: XP_022020598
AA seq 707 aa AA seqDB search
MSCISSFFIRQENMFILDGKLLVWLFSFIFIHLIHTTTLAQPEFLSYFCESAANYTVNSP
YQRNLNITLSTLPTTNNGFGFYNRTIGQGNNDTVHSIALCRGDVNPDVCQSCLNDSIVKL
RQLCPNQKEAIGYYDYCVVKYSNQVILGSTRIKFYVYLANPQNATDIDRFNGALGPLMKD
LRGNASAGGPLRKFASGSTTGPDFSTIYGLVQCTPDLSELDCDSCLEDAINRIAQWFNGK
IGGRILLPMCTFRYENYRFFNQSAAVIPPSPPPVLQPSPPIARPSPPPGKKNNTTRNVII
ITIIVIVTVIIIMALLCIIIMRFKKKRQMTPSTTPTRIQTDTTTMDISTVESLQYDFSAM
KAATNDFSEENKLGRGGFGSVYKGKLTEGDQIAVKRLALDSGQGDLEFKNEVLLMAKLQH
RNLVRLLGFSIQGSERLLIYEFMPNASLDQFIFDPTKRTILDWEKRYNIIKGIAKGLLYL
HEDSRLRIIHRDMKASNVLLDAQMTPKIADFGMARLFKTEETQGDTSRIVGTYGYMAPEY
AMHGQFSVKSDVFSYGVLVLEMVTGQKNQCFRNEESVEDLLSFAWKSWRNGTASDIIDPI
LKTGSGSLRDIIRSIHIGLLCVQENVTDRPTMASVVLMLNSFSITLPVPTKPAFFVRSTV
DPEMPHIQEYSSSTKSSGLEKSKLSKSRSRSSQYSLNEVSISDFGPR
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgcatctcctctttcttcatacgacaggaaaatatgttcatccttgatggaaaa
ctgctggtatggctattttcttttattttcatacatctaatccatacaaccaccttagct
caaccagaattcctttcctacttctgcgaaagcgcggctaactataccgtaaacagcccg
taccaaagaaatctcaacatcaccctctccaccctccctaccaccaacaacggctttggt
ttctacaatcgcaccatcggccaaggcaataatgatacagtccactcaatcgccctttgt
cgaggcgacgtcaaccctgatgtttgccagagttgtcttaatgactccattgttaaattg
cgacagctctgcccaaaccaaaaggaagcaataggatattacgactattgtgtggtgaag
tactccaaccaggttatattgggaagcacaagaataaagttttatgtgtatctggctaac
ccgcaaaatgcaacggatattgatcggttcaatggtgctttggggccactaatgaaggat
ctgagaggaaatgcatccgctggcggtcctctacggaagtttgcgagcgggagcacgact
ggtcctgatttctcaacgatttatgggcttgtgcagtgtactcctgacctgtcggagcta
gactgcgactcttgcttggaggatgcaatcaatagaattgcacaatggtttaatgggaaa
attggaggaagaattcttttgcctatgtgtacttttagatatgaaaactatcggtttttc
aaccagagtgctgcggtcatcccaccatcaccaccaccagttttgcagccatctccgcca
attgcacgaccttcaccaccaccaggcaaaaagaataacacgacaagaaatgtgataatc
ataacaattattgttatagtcaccgtcattataataatggctttgctttgtatcataata
atgagatttaagaagaaaaggcaaatgacaccttcaacaacccccacaaggattcagacg
gacacgacgaccatggatattagcacagtggaatccttacagtacgattttagtgcaatg
aaagcagcaacaaatgacttttcagaagaaaacaagctcggacgaggtggttttggatcg
gtttacaagggtaagcttacagaaggggaccaaatagcagtaaagaggttagcattggat
tcgggacaaggtgacctagaattcaagaatgaggtgttgctgatggcaaaacttcagcat
cgtaatttagtccggttgctaggtttcagcatacaaggaagtgaacgacttctcatttat
gagttcatgccaaatgcaagccttgatcaatttatatttgatccaactaaacgtacaatt
cttgattgggaaaaacgttacaatataatcaaaggaattgcaaagggactactatacctt
catgaagattcccgtctaaggatcattcatcgtgatatgaaggcaagtaatgttttgttg
gacgcccaaatgacccctaaaattgctgattttggcatggcaagattgtttaaaaccgag
gaaactcaaggagacacaagccgaattgttggaacctatggttatatggcgcccgaatac
gccatgcatgggcaattctcagtaaagtcggatgtctttagttatggggtgttagtacta
gagatggtaacaggtcaaaagaaccaatgctttcgtaacgaagagagtgtagaagatctt
ttaagctttgcatggaaaagttggcgtaatgggacagcatcagatataatagatcccata
ttgaagaccggatcaggttcattgcgtgatattattagaagcatccacatcgggttatta
tgtgtccaagaaaatgttactgacagaccaaccatggcttcagttgttctaatgcttaat
agcttctctatcacacttccggtacccacaaaacctgcattttttgtacgtagtaccgtt
gatccggaaatgccacatatacaggagtacagttcttcaacaaagagcagtggtttagaa
aaatctaaattatcaaaatctagatccagatcttctcagtattccttaaatgaagtttca
atatctgattttggtcctagataa

DBGET integrated database retrieval system