KEGG   Helianthus annuus (common sunflower): 110920802Help
Entry
110920802         CDS       T05101                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PIX13
Organism
han  Helianthus annuus (common sunflower)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 110920802
NCBI-ProteinID: XP_022020693
AA seq 411 aa AA seqDB search
MGICSSSTNIAPTTTHNLSSVTGSSHTTNRTGSTSISSSGISSNLSGNSQFSSVSSGDDL
GPGGQILAHPNLKIYTFSELKSATKNFRNDTILGEGGFGKVYKGWISSSVIAVKKLNSES
MQGIEEWQAEVNFLGRLSHPNLVKLLGYCYEGKELLLVYEFMQRGSFENHLFGRGSTVQP
LPWDIRLKIAIGAARGLSFLHTSDKKVIYRDFKASNILLDGSYNAKLSDFGLAKLASASQ
SHVTTRVMGTYGYAAPEYVTTGHLYVKSDVYGFGVVLVEMLTGMRTLDNGRPAAQRNLVD
WVKPYLGNRRKLKNVMDPRLEGRYPSKAAGQVAQLALTCLGNEQKTRPSMKEVVATLERL
GDIKERPKVPRIHNSSPRSPYPNGKQPLRHRSPLHVKEDVSQRSQDSPKGS
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgggtatttgcagttcttcaactaatatagctcccaccaccactcacaacctcagttca
gtaacaggtagttcacatacaaccaacagaacaggctcaacatcaatatcatcatcagga
atcagtagcaatttatctggaaacagtcagttttcatcagttagcagtggtgatgatctt
ggtccaggtggccagatcttggctcatccaaatcttaaaatatataccttttcggaactc
aaatccgctacgaaaaactttcgaaacgatacgattttaggtgaaggtggttttggtaag
gtttacaaaggctggataagcagttctgtaattgctgtcaagaagttgaattctgagagt
atgcaagggattgaagagtggcaggccgaggtaaacttcttaggaaggctttcgcatcca
aatctcgtaaaacttttgggatattgttatgagggaaaagagcttttacttgtatatgaa
ttcatgcaacgaggcagcttcgagaaccacctttttggaagggggtcaactgttcagccg
cttccatgggatatacggcttaagattgcaataggagcagctcgtgggctgtcgtttttg
cacacttcggataagaaggttatttatagagactttaaggcgtcaaacatattgcttgac
gggtcgtataatgcaaagctatcggattttgggctggctaaattagcatcggctagccaa
tcgcatgtgaccacacgggtgatgggtacatatggttatgctgctcctgaatatgttacc
acaggacacttgtatgtgaagagtgatgtctatggtttcggcgttgtgttggttgagatg
ttaaccggcatgcggacactcgacaatggtcgtccagctgcccaacgaaatcttgtcgat
tgggtcaagccgtatctgggcaaccgtaggaagttgaagaacgtaatggacccacggctt
gaaggaagatacccttcaaaagcggcaggccaggttgcccaactagctctcacgtgtctt
gggaacgaacagaaaacccgtccatcaatgaaagaagtggtggcaacgctagaacgacta
ggggatatcaaagaaaggccaaaagtacctagaatacacaattcaagtcctcgctcgcca
tacccaaatggtaaacaacctttgcgacatcgttcaccgcttcatgttaaggaagatgta
agccaaaggagccaagattcaccgaaagggtcatga

DBGET integrated database retrieval system