KEGG   Helianthus annuus (common sunflower): 110921843Help
Entry
110921843         CDS       T05101                                 

Definition
(RefSeq) putative receptor protein kinase ZmPK1
Organism
han  Helianthus annuus (common sunflower)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr B_lectin S_locus_glycop PAN_2 PAN_1 PAN_4 PIP49_C PAN_3 EGF_3 APH
Motif
Other DBs
NCBI-GeneID: 110921843
NCBI-ProteinID: XP_022021866
AA seq 805 aa AA seqDB search
MLIHSQYIMHLPFLFLLPLITLYYSQQVAPVSSSSSSSQSVLTQGSSLLVEKKHHLVSPN
GLFTAGFHEIGQNAYLFAIWFSEPMLDGNHTLVWMANRDWPVNGKHSRFSLLKNGNLVLT
DAGGQRIWTTDTQSSSPLQLQLLDSGNLVLTRLGTKSFLWQSFNFPTHTLLPNQPFTKDT
ELISSRSSTNLSSGFYKLYFDSGNVIRLLYSRNEVNVTNIYWPPPTLRTWEAGRNNNNNS
KFAFLDSKGRFLSSDNLTFTTTDYGDSLQRRITLDVDGNVRVYSLNQGNWSVTWQTFSAP
CLYGICGPNSLCTHSLESGRICTCMHGYRSKNHSDLSFGCEPTFDLSQHRENFGFIKLPH
VEFVGFDSIYNRKSTLKECTNYCLNDSNCKAFQFAFDEKLAAFTCNVKTLLFSGYYKGPS
FTTFLKLPKNDVLSYNQYVANKSSLECSSSIIKLERTYQKKNSNGSIKFILWFSIILGAI
EVASFVLIYCITKEPSGTTTQTYLAIATGFKRFTYAEIVKASHKFGEEIGRGGGGIVYKG
ILPDNRVVAIKRLHDATQGEAEFLAEMSTIGRINHRNLIETYGYCAEGKHRILVYEYMEN
GSLAGKLGGNQLEWKNMFEIASGIAKGLAYLHEECLEWVLHCDVKPQNILLDGDYNPKVA
DFGLSKLFHQGVTGNSLFSRIRGTRGYMAPEWVFNLPITSKVDVYSYGMVVLEMITGQGP
TYDQSRDDNERLEQKRLVGWVREKVHVASESLTETQFIEILNPMISGKYEKDQMNNLLKV
ALKCVEEDKDARPTMSEVVKMLGDG
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgcttattcattcacagtacatcatgcatttgcccttcctatttctcttacctttaata
accctctattactcacaacaagttgctcctgtttcttcttcttcttcttcttcacaaagt
gttttaacccaaggttcatcactcttggttgaaaagaaacatcatttggtttcaccaaat
ggccttttcacagccggatttcacgaaattggccaaaatgcttatttatttgcaatatgg
ttctcagagcccatgttggatggaaatcacacattggtttggatggcaaaccgagattgg
cctgtcaacggaaaacactccaggttttccttgttgaaaaatggtaaccttgtcctaacc
gatgctggtggccaaagaatttggacgaccgatactcaatctagttcgcctttgcaacta
caacttcttgactcgggtaaccttgtccttacacggttaggaacgaaatcatttctttgg
caaagcttcaattttccaacccacactctccttcccaatcaacctttcaccaaagataca
gaactcatttcttcgagaagttcgacaaatttgtcttctggcttctacaaactctatttt
gacagtggcaatgtaatccgccttctttacagcaggaatgaagttaacgttaccaacatt
tattggcctccaccgactttaagaacatgggaagcaggaaggaataataacaacaacagt
aaatttgcttttcttgattccaaagggcgtttcctctcttcagacaatcttacctttact
accacggactatggtgattccctccaaagaagaataacacttgatgttgatggtaatgtt
agagtttactcgcttaaccaaggaaactggagtgttacatggcaaacattttcagcacca
tgcttatatgggatatgcggtccaaacagcctttgtactcacagcctggaatcaggaagg
atatgcacttgtatgcatggatacaggagcaagaaccactcggatttgtcttttgggtgt
gaacctacatttgatctttcccagcatcgtgaaaactttggattcataaagctccctcat
gtagagtttgttggatttgattctatttataatagaaagtccactctcaaagaatgcaca
aactactgcttgaatgactccaactgtaaagctttccagttcgcctttgatgaaaagttg
gccgcctttacatgtaatgtcaagactttgttgttcagtggctactataagggtccttct
ttcaccacttttcttaagctaccaaaaaatgatgtcttatcgtacaatcagtatgttgca
aacaagtccagcttggaatgctctagttctataattaagctagaacgaacataccagaaa
aagaattcaaatgggtccatcaagttcattttgtggttcagcatcatccttggggcaatt
gaagttgcatcctttgtattaatttattgcatcaccaaagaaccatcaggtacaacaacc
caaacctacctagcaattgctaccggattcaaaaggtttacatatgcagagatagtgaag
gcatctcataaatttggagaagaaattggaagaggtggtggcggtattgtgtacaaaggc
atacttccagacaatcgagtggtagcaattaaacgactccatgacgctacccaaggagaa
gctgaatttctagcagagatgagcacaatcggaaggataaatcataggaacttgatagaa
acatatggttattgtgctgagggaaagcataggatcttggtgtatgagtacatggagaat
ggctcattagcagggaaattaggtggtaaccagcttgagtggaagaatatgtttgaaatt
gcttctggcattgcgaaaggactagcttacctacatgaagaatgcttggagtgggttttg
cattgcgacgttaaaccacaaaatatattgttggatggtgattataacccaaaggtggct
gattttggtttatccaagctattccaccaaggtgtaacaggaaattctctcttttcaagg
ataagagggactagagggtatatggctccagagtgggtgtttaatcttccaattacttca
aaagtggatgtttatagctacgggatggtggtgctagagatgataacaggacaaggtccc
acatatgaccaatcacgtgatgataatgaaaggttggaacaaaagagactcgtaggttgg
gtaagagagaaggtccatgtggcaagcgaaagtttgacagagacacaatttatagagata
ctgaatcctatgataagtggtaagtatgaaaaagatcagatgaataatcttctgaaagtg
gcactaaaatgtgttgaggaagataaagacgctcggccaaccatgagtgaggttgtgaag
atgcttggagatggatga

DBGET integrated database retrieval system