KEGG   Helianthus annuus (common sunflower): 110921894Help
Entry
110921894         CDS       T05101                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase LECRK3
Organism
han  Helianthus annuus (common sunflower)
Brite
Enzymes [BR:han01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110921894
Protein kinases [BR:han01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110921894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr B_lectin S_locus_glycop PAN_3 PIP49_C PAN_2
Motif
Other DBs
NCBI-GeneID: 110921894
NCBI-ProteinID: XP_022021910
AA seq 806 aa AA seqDB search
MPQVFTTHNLLMISLGHIMASLLLLLAFSFLQFIHTRVDGASSQSISLGHSIVAGAQSSD
AWYSQSELFAFGFYPQGTGYVVAIWLVIDEENPVVWTAYRDDPPVSPNSTLELTHKGELV
LFSDERVIKIIAVNVSYAVMNNSGNFVLYNDDMGVVWQSFDFPTDSMLQGQKLSAGSELV
SSVSKTNYSSGRFRIKLQMDDNIVMYPTNTDDTSINAYWASGTYDFAFNNSKNYLYLNNT
GLLLINGSNSQVKRPLYTDNLYPAIRRVTLCDDGIFRLYSYNHTNSTPSTVWEVPVQRCY
VKNFCGLNSYCTMNDDQPYCVCLPGSDYIDLTQKSSGCQRNFTKATCINGKENTTDYKMV
TKEKLMWRSHPYYQGLTDNKEDCSNTCLEDCDCNAALWKEDESYCEKHKYPLRDVRRVYA
DDEISTAFFKVGTVSLYGQANDSFNSSSVEVPQGVVKKTWVLILVITIGFSIYSCISLSL
SGFFVFKTRLLKYKRLLESRTMGLAEDLILRSYTYNELRKATNGFKQELGRGSFGTVYKG
CIYKGNKTIAVKRLEKVVDEGEREFRAEMQVIGKTHHRNLVRLLGYCAEGKSERLLVYEY
MSNGTLADRLFKSERLPDWSERVQIALDVARGILYLHEECESPIIHCDIKPQNILMDDFW
TAKISDFGMAKLLMPDQSKTFTDARGTRGYLAPEWQKNIPISVKVDIFSYGIVLLEIICC
RRNLEVHVSNTEEIVLSNWVYKCFERGQLELLVTNEEVEKESLERLVKVGLWCIQDDPAL
RPTMKCVVLMLEGITNIATPPCPTST
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgccccaagtctttacaacacacaatttactgatgatttctttggggcatatcatggct
tcattactattactgcttgccttttcctttcttcaatttatccataccagggttgatggt
gcgtccagtcaatctataagcttgggtcattcaattgtagctggtgcacaatcaagtgat
gcatggtattcacagtctgagctgtttgcattcgggttttatccccaaggcactgggtat
gtggttgcaatctggttggtgatcgatgaagaaaatcctgttgtgtggactgcttatcga
gatgatccacccgtttcaccaaatagcacactagaacttacccataaaggggaattggtt
ttattctccgacgaacgtgttattaagatcattgcagtcaatgtttcctatgctgtgatg
aataacagtggaaattttgtactgtacaatgatgatatgggtgtagtgtggcagagtttt
gactttcctaccgattccatgttacaaggccagaagctgtctgctgggagtgaattggtt
tcaagtgtctctaaaaccaattactctagtggacgttttcgtatcaagttgcagatggat
gacaatattgttatgtatccaacaaacacagatgacacaagtataaatgcttactgggct
agtggcacctatgactttgcattcaataactcaaagaactacctgtaccttaacaatacc
gggttactgcttataaatggaagtaactcacaagtcaagaggcctctttataccgataat
ctttatcctgccatacgccgtgtgacactttgtgatgacggaatatttcggctatattct
tacaatcacactaactccaccccttccacagtatgggaagtgccagttcaacgttgttat
gtgaagaacttctgtggattaaacagctattgcactatgaatgatgatcagccttactgt
gtttgcctgccaggttctgattatatagatcttactcagaaatctagtggctgccagagg
aatttcacaaaagcaacatgcataaacgggaaagaaaacacgacagattacaagatggtc
accaaagagaaattgatgtggagaagccatccatactatcagggcctcactgacaacaaa
gaggactgcagcaatacctgtttggaggattgtgattgtaatgctgctctttggaaagaa
gatgaatcttactgtgagaaacacaagtacccattgcgggatgtaagaagagtttatgct
gatgatgagatatctacggctttcttcaaggtgggcacggtaagcctatatggccaagct
aatgattcctttaactctagttcagtagaggtgccacaaggggtggtgaagaagacatgg
gttctgattcttgttataaccatcgggttttccatctattcatgcatttccctaagtttg
tctggatttttcgtatttaaaacccgtcttctgaagtacaagagactgttggaaagtaga
actatggggttggctgaagacctcatcctaagatcgtatacttacaatgagcttcgaaag
gcaactaatgggttcaagcaagagttaggaaggggttcattcggaacggtctataaaggg
tgtatttacaaggggaataaaacgatagcagtgaagagacttgagaaggtggtagatgaa
ggcgagagagaattccgagctgaaatgcaagtgattggaaaaacccatcacagaaatcta
gtccggctgctcggttattgtgcagaaggtaaatccgagaggcttcttgtttatgagtac
atgagcaatggaacccttgctgaccgtctgtttaaatcagaaaggctaccagactggtct
gagagagtgcaaatcgcgcttgacgttgcaagaggaatcctttaccttcatgaagaatgt
gaatcacccatcattcattgtgacataaagccccaaaacattttaatggatgatttctgg
actgctaaaatctctgactttggaatggccaaactactcatgccagatcaatctaagacg
ttcacagatgctcgaggcactagagggtacttggcacctgagtggcagaaaaacatccca
atatcagtgaaggttgatattttcagctatgggatcgtgttgcttgaaatcatatgttgc
agaaggaacttggaagtacatgtatccaatacagaagaaattgtgctctctaattgggtt
tacaagtgctttgaaagagggcaattggagctgcttgttaccaatgaagaagtggagaag
gagagtttggagaggcttgttaaagtaggactttggtgcatccaggacgaccctgctctc
cgtcccactatgaagtgtgtggtgttgatgttagaagggatcacaaacattgctactcct
ccctgtccaacttccacatga

DBGET integrated database retrieval system