KEGG   Helianthus annuus (common sunflower): 110922435Help
Entry
110922435         CDS       T05101                                 

Definition
(RefSeq) glutathione S-transferase-like isoform X1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00350  Tyrosine metabolism
han01100  Metabolic pathways
Module
han_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    110922435
Enzymes [BR:han01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     110922435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 EF-hand_1
Motif
Other DBs
NCBI-GeneID: 110922435
NCBI-ProteinID: XP_022022428
AA seq 149 aa AA seqDB search
MLKGEKKTPEFLNVNPIGYVPALVDGDLVMVDSFAIIMYLEEKYPQHPLLPRDHAKKAII
YQNGRIDYNEFVAMVHNGSATLTKKQLKDDFSAGLREPVPVSCFLFVFIVSYKWHTVKSG
CTEFTFIHGAHTYTLIHEFYRIFHNISHY
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaggagaaaaaaaaacccctgagtttctaaatgtgaatcctattggatatgtg
cctgcattggtggatggtgacttagtcatggttgactcttttgcaatcatcatgtacctt
gaagagaagtatcctcagcatcctttgctgcctcgagaccatgcgaaaaaggcaatcatt
taccagaacggccgtatagattataatgaatttgtagcaatggtgcacaatggaagcgcg
acattgacaaagaagcaattgaaggatgattttagtgccgggttaagggagccggtgcca
gtttcttgttttttatttgttttcattgtttcatataaatggcacacagtaaaaagtgga
tgtacagagttcacattcatacacggggcgcacacatatacacttattcacgagttttat
agaatatttcataacatttctcactattag

DBGET integrated database retrieval system