KEGG   Helianthus annuus (common sunflower): 110923078Help
Entry
110923078         CDS       T05101                                 

Definition
(RefSeq) LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
han  Helianthus annuus (common sunflower)
Brite
KEGG Orthology (KO) [BR:han00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:han01001]
    110923078
Enzymes [BR:han01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110923078
Protein kinases [BR:han01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110923078
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like ABC1 APH YukC
Motif
Other DBs
NCBI-GeneID: 110923078
NCBI-ProteinID: XP_022022950
AA seq 315 aa AA seqDB search
MTGSFKVKLGQGGFGQVFKGKLCDGRLVAVKVLNSSKENGQEFINEVASIGRTSHVNIVT
LLGFCFDNKKRALVYEYMPNGSLEKYIYSHVHAGTNEHIGVEKMYEIALGVACGLDYLHR
GCNTRILHFDIKPHNILLDEDFCPKIADFGLAKLYSRKESIVSMFEARGTIGYIAPEVYN
NNFGGVSHKTDVYSFGMLLLEMAVGGRKNVDAGVGSGRTSEIYFPDWIYNRLHKNEFLLD
SVATREENDYARKMTIAGLWCIQPAPNQRPSINEVIEMLEGSMDTMEVPPKPFFSSPPRS
PATIYSTSESMQEAI
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgactggctcgtttaaagttaaattaggacaaggaggtttcggacaagtgtttaaagga
aagctatgtgatggtcgacttgtggcggttaaagttttaaattcctccaaagaaaatgga
caagaatttattaatgaagttgcaagcattggtaggacttcccatgttaatattgttact
ctcttgggattttgttttgacaataaaaaaagagctcttgtatatgagtacatgccgaac
ggatcattagagaagtatatatatagtcatgtacatgcggggacaaatgaacatatagga
gtagaaaaaatgtatgaaattgcacttggagtagcatgcggtcttgactatttgcatcgt
gggtgcaacactcggattctgcattttgacataaagccacataacatactgcttgatgaa
gatttttgtcccaagatagcagattttgggcttgctaagttgtactcgaggaaagagagt
attgtttctatgttcgaggctagaggaacaataggttatattgctccagaagtttacaat
aataactttggaggagtctctcacaaaacggatgtgtatagttttgggatgttgttacta
gaaatggcggtagggggtagaaaaaatgttgacgcgggtgttggttctgggcgtactagt
gagatatattttcctgactggatctacaaccgtcttcataagaatgaattcctattagat
agtgtagcaactagagaggaaaatgattatgcaagaaagatgacaatagcaggtttatgg
tgcatacaacctgctccaaatcaaaggccgtccattaatgaagtgatagaaatgttagag
ggaagcatggacacaatggaagtccctccaaaaccgttcttttcttctccaccacgatcg
ccagctactatatatagcacatcagaaagcatgcaagaggcaatataa

DBGET integrated database retrieval system