KEGG   Helianthus annuus (common sunflower): 110924754
Entry
110924754         CDS       T05101                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00100  Steroid biosynthesis
han01100  Metabolic pathways
han01110  Biosynthesis of secondary metabolites
Module
han_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    110924754
Enzymes [BR:han01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     110924754
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 110924754
NCBI-ProteinID: XP_022024440
AA seq 372 aa
MPMDFFTPLLTSFIPSCNSVYLLLGFLSYLGISGSVLPGNVVAGASLADGTRLHYRCNGL
ISLLLLVGLLLVGAWMDLVSLTAISDRGLELLSTTFIFSVIVTLLLYVAGCKSKDRSASL
KPHVTGNIIDDLWFGIQLNPNFLGVDLKFFFVRAGMMGWLLINLSVLAKSIQDANLSRSM
ILYQLFCVIYIMDYFFYEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLSNNV
DLPTAAIVANCFVFLIGYLVFRGANKQKHDFKKNPKALIWGQPPKVIAGKLLVSGYWGIA
RHCNYLGDLLLALSFSLPCGISSPVPYFYPTYLLILLIWRERRDEARCAEKYKDVWVKYR
QAVPWRILPYVY
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgccgatggacttcttcactccccttctcacctccttcattccatcatgtaattctgtg
tatttgttactgggattcttgagttatttggggatttctggatctgttttgcctgggaat
gttgttgctggtgcgagtttagctgatggaactagacttcattatcgttgtaatggactg
atatcacttcttttgctggttggactgcttttggttggagcttggatggatcttgtgtca
cttaccgcaatttcagaccgagggcttgagcttttatctacgacttttatcttcagtgtt
attgttacattgttactttatgtggctggctgtaaatctaaagaccggagtgcatctttg
aagcctcacgtcactggaaacataattgatgacttgtggtttgggatacagctaaatcct
aacttcttgggcgttgacctcaaatttttcttcgtgagagctggaatgatgggatggctt
cttatcaatctttccgtgcttgcaaaatctatccaagatgctaacttgagccgatcaatg
atcctctaccagctgttttgtgtgatctacattatggattacttcttctacgaggaatac
atgacatctacatgggatataattgcagagagattagggttcatgctagtatttggagat
ttggtgtggattcccttcacatttagcattcagggctggtggcttttgagtaacaatgtg
gacttaccaacagccgcaatcgttgcaaattgctttgtatttctgatagggtatcttgtc
tttagaggtgctaacaagcaaaaacatgattttaagaaaaatcccaaagccctaatttgg
ggtcaaccaccgaaagttatcgcaggaaaattacttgtttctggttattggggtatagca
aggcactgtaattaccttggcgatttgttactggcactatccttcagcttaccatgcgga
ataagctctccggttccatatttttatccgacatatcttctgattctgctgatatggcgc
gagagaagagacgaagctcgatgtgcagagaaatataaagacgtttgggtgaaataccgg
caggctgtcccatggaggattctgccatacgtttactaa

DBGET integrated database retrieval system