KEGG   Helianthus annuus (common sunflower): 110925471Help
Entry
110925471         CDS       T05101                                 

Definition
(RefSeq) L-type lectin-domain containing receptor kinase IX.1-like
Organism
han  Helianthus annuus (common sunflower)
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_legB Pkinase Pkinase_Tyr Bact_lectin Lectin_leg-like PIP49_C APH Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 110925471
NCBI-ProteinID: XP_022025114
AA seq 636 aa AA seqDB search
MVFSMFHLITYLLLLSVPLAFSITFNLTNINPRHQNRDIVMEGMGANISNGGIQLTTNGQ
ATYFRSLHLWDRRTQELASFSTSFTFVILTNGSNSYGDGLTFFLAQSSSVTQGGYMGLPF
NTRPDFENSPFVAVEFDTMDDHVGINVHSVSSAKSQNWFSNVTGSGVCQAWITYDSVMKD
LTVSIAGFKNSTVVPQEGLVHKVDLKKELPEWVNFGFSAPFGVMFQRYTVRSWSFESSDL
LVDKNKEWPPVPSPNRVKGKLSKMSSIVGFTVMISFLVVLAFVFWMKKKSRVIVSKEITF
SVEMNNEFERGLGPKQFSYLELVQSTSDFSENNKLGDGDFGRVYKGFLKDTNKYIAVKRV
SKSYEQGIEEYASEVRIISQLRHKNLVQLIGWCHEKGELLLVYNYMENGSLDSHLFKGKS
LLAWGTRYKIANGLASALWYLHDGWEQCVLHRDVKSGNIMLDSNFNAKLGDFGLAKLVDR
EKVLETITSDATVIDCIVSECVIAGKTPKESDVHSYGVVALEIACGQKLINNKAQEKLTQ
FIEWLWELYMTDTLIEAIDPHLGSDFEEEEIKRLMTVGLWCVHPRSELRPSMRQVIQVLN
FEASLPVLHSTMPMASHISSGYACFNYQQAFNQYPL
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggtgttctcgatgttccatttgatcacttacttacttcttctctccgttcctttggct
ttctcaattaccttcaatttgacaaatatcaatccacgacatcagaatcgggacatagta
atggaaggtatgggagctaatatttctaacggtggaatccagttaaccacaaacggacaa
gccacatactttagatcacttcatctttgggacagaagaactcaggagctagcaagcttc
tctaccagtttcacctttgtgattctaacaaacgggagcaattcttatggtgatggcctt
acattctttcttgctcagagttcttcagttacccaaggtggctacatggggcttccattc
aataccagaccagatttcgaaaacagcccatttgttgcggtggagttcgataccatggat
gatcatgtgggtatcaacgttcattctgtttcctctgctaagtctcaaaactggttcagc
aatgtaactggcagtggagtttgtcaagcttggataacctatgattcggttatgaaagat
ttgacagtttctatcgctggttttaaaaacagtacagtggtgcctcaagagggacttgtt
cacaaggtagacctaaagaaggagttgcctgaatgggttaatttcgggttttcagcacct
ttcggagttatgttccagagatataccgtgagatcttggagctttgaaagttcggattta
ctcgttgataaaaacaaggagtggccaccagtcccgagccctaatagagtgaaggggaaa
ctcagcaagatgagttcaattgttggattcacggtaatgattagttttcttgtggtgctt
gcatttgttttctggatgaagaagaagagcagggtgattgtatcaaaagaaattacattt
agtgtcgagatgaacaatgaatttgaaaggggactcgggcctaaacaattctcttacctc
gaattagttcaatcgacaagtgacttttctgagaacaataagctaggggacggagatttt
ggtcgtgtttacaagggttttttgaaagatacaaacaaatacattgcagtcaaaagggtg
tcaaagagttacgaacaagggatcgaggagtatgcatcggaagttaggatcattagccaa
ctaagacataaaaacctggtccaactaattggttggtgtcatgagaaaggcgaactcttg
cttgtttacaattatatggagaacggaagtttagattcacatcttttcaaggggaagagt
ttgttggcatggggcacaaggtacaaaattgcaaacggtttggcatctgctttatggtat
ctacatgatgggtgggagcaatgtgttttgcatagagatgttaaatcgggtaatataatg
ttggattcaaatttcaatgcaaagcttggtgattttggattagctaagctggttgatcgt
gaaaaagtcttagaaacaataacgtcggatgcaaccgtcatagattgcatagtttctgaa
tgtgtaatcgccggcaagacaccaaaagaatcagatgttcatagttacggagtagttgcg
ttggaaatagcttgtggtcaaaaactcattaacaacaaagctcaagaaaagctaacgcag
tttatagaatggttatgggagctctacatgactgatactcttattgaagcaattgaccca
catctagggtcagattttgaagaagaagaaatcaagcgtcttatgactgttgggttatgg
tgtgtgcaccctcgttcagaactccgcccatcgatgagacaagtaattcaagtactgaat
tttgaagcttccttgcctgtactccactcaaccatgccaatggcatctcacatttcctca
ggatatgcttgcttcaattatcaacaagcattcaaccagtaccctctataa

DBGET integrated database retrieval system