KEGG   Helianthus annuus (common sunflower): 110925663Help
Entry
110925663         CDS       T05101                                 

Definition
(RefSeq) (E)-beta-farnesene synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    110925663
Enzymes [BR:han01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     110925663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth Importin_rep_6
Motif
Other DBs
NCBI-GeneID: 110925663
NCBI-ProteinID: XP_022025245
AA seq 563 aa AA seqDB search
MPASKSPPSLNHNKSFKQAVRSTVNFHRSIWGDQFLSYNERKDQACEEQRATELREKVRK
ELVIARSIEPTQHIKLLELIDAVQRLGVSYHFEDEIEECLNNIYLMYGDQWIDDDNLQST
SLWFRLLRQQGFNVSSGIFYKYKDENGHFLKSMKDDIHGMLSLYEATHMRVEGEEVLDEA
LEFTRYHLRNMIKKNICNDVSLETQIHQALQQPLRKRLPRLETLRYIPIYQQQDSRNDDL
LTLAKLDFNLLQELHRKELSQISKWWKNFDVSNKLPYVRDRIVEGYFWILAVYFEPQHSE
SRIFLMKACNLVIILDDTYDNYGTYEELEIFTKAVQKWSISCLDMLPEYMKPIYQELLDV
HKEAEEFLEKTGKTYRSYYTKEMVKEYTRNLLIEAKWANERYIPTVEEHMSVTLITCAYA
MIIAKCYVYGEDSVTEHTFEWVSTYPPIVKASCLILRLMDDMATHKEEQERNHVASSVEC
YMKQYGISEEQTHELFTKLVEDSWKVINQESLRPTEVPRPLLMPPTNLARVCDVLYTRGD
DYNHAGKEMISHIKSLLVDRLSV
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgtctaaatctcctccatcccttaaccacaacaaaagttttaagcaagccgtc
cgcagcacggtgaacttccatcgtagcatttggggagatcaatttctctcgtataatgag
agaaaggatcaagcttgtgaggagcaacgtgctacggaactaagggagaaagtgaggaaa
gagctagtgatcgctagatcaatagaaccaacacaacatattaagttgttggaacttatt
gatgcggtccaacgccttggtgtatcgtatcattttgaagatgaaatcgaggaatgttta
aataatatttatcttatgtatggggatcagtggatcgacgatgataacctccaaagcact
tcactttggtttagactcctacgacaacaaggcttcaatgtttcaagcggaatattctac
aagtacaaggatgaaaatggtcactttttgaagtctatgaaagatgatattcacgggatg
ttatctttgtacgaagcaacacatatgcgggtggaaggcgaagaagttcttgacgaagcc
ctcgagtttacaagatatcatctccggaatatgatcaagaaaaacatttgtaacgacgtt
tcgcttgaaactcaaatacatcaagcactacaacaacctcttcgaaaaagattgccacga
ctagagactttgcgttacataccaatctatcaacaacaagattctcgtaatgatgactta
ctaacacttgctaagttagatttcaatttactccaagaacttcaccgaaaggagcttagc
caaatcagcaaatggtggaagaactttgatgtctccaacaaactaccttatgttcgggac
agaatagtcgaaggttacttttggatattggcggtctacttcgagcctcaacattctgaa
tcaaggatttttctaatgaaagcttgcaatcttgtgatcattttggatgacacatatgat
aactatggtacatacgaagagctcgagatctttactaaagcggttcaaaaatggtcgata
agttgcttggatatgcttcctgaatatatgaagccgatataccaagaacttcttgatgtt
cacaaagaagccgaagaattcctagagaagacaggaaagacataccgtagctattataca
aaagagatggttaaagagtacactcgaaacctcttaattgaagccaaatgggcaaatgag
aggtatattccaaccgttgaggaacatatgtcggttacacttattacttgtgcctacgcc
atgatcatcgcgaaatgttatgtttatggggaagattcggtgaccgagcatacatttgaa
tgggtgtcaacttatcctcctattgtcaaagcttcttgtttgattttaaggcttatggat
gatatggccacacataaggaggaacaagaaagaaaccatgtagcttctagtgtcgaatgt
tacatgaagcaatacgggatctcagaggagcaaacacatgagttgttcacaaaactagtt
gaagatagttggaaagttataaatcaagagtctctaaggccaaccgaagtcccgagacct
ttacttatgcctccaactaatcttgcacgagtttgtgatgtgctttatacgcgtggtgat
gattataatcatgctggaaaagagatgatcagtcacattaaatcacttctcgttgatcgc
ttaagtgtttaa

DBGET integrated database retrieval system