KEGG   Helianthus annuus (common sunflower): 110929247Help
Entry
110929247         CDS       T05101                                 

Definition
(RefSeq) L-type lectin-domain containing receptor kinase IX.1-like
Organism
han  Helianthus annuus (common sunflower)
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_legB Pkinase Pkinase_Tyr Bact_lectin Lectin_leg-like Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 110929247
NCBI-ProteinID: XP_022028078
AA seq 687 aa AA seqDB search
MSLLTFFLLSLIPYAASVTFNFTKLSPKDSHDIIFSGDAAYSSNEGLQVTHKRKGDQYGS
VWLAGRATYIKPLHLWDADSTDLVSFSTSFTFVIDSYPNNYYADGLTFFLAHNNSVINSG
GILGLPFDSTIQTSKHRFVAVEFDTYGENDWDPRDPATNISIGDHVGIDINSVTSVVSRK
WFSNITYGKECRALITYNADSKNLSVSFTSFKNNSVVWETGLDYTIDLRHVLPEWVIFGF
SASTGNHFEKNNVVCWTFNSTDLKVDENKRENNLLRMMGITFGTLVPVTCLAIFAYFVWN
RRTDDGYEGEELGLLEMTNEIEMGASMPRRFSYHQLARATANFAETEKLGEGGFGGVYKG
FLKNVRMYVAVKMVSKTSKQGIKEYASEVRIISRLRHRNLVQLIGWCHDKGNLLLAYEFM
ENGSLDLHLFKGKSLLTWNIRYKIAHGLASALLYLHEEWEQCVLHRDIKSSNVMLDLNFN
AKLGDFGLAKLVDHEKDAQTTMLAGTLGYMAPECIVTGKPTKESDVFSFGIVALEIACGR
SAIDYKAQEKQTWLVEWVWELYGNDTVLGAVDPSLGLEFEEDEIRRLMILGLWCVHPDPE
FRPSMRQAIKVLNSDASLPSLPSKMPVASYSTPGVPSLSDFSSSDQYQSLSRSIEPLSTD
SSKKTTSSTNSSYSKSISVFHSIQGNV
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgttaacattcttccttctttctttaatcccttatgcagcttcagttacattc
aatttcacaaaacttagtccaaaagattcccatgatataatattctcaggtgatgctgct
tatagctctaatgaaggcctccaagtgacccacaaaaggaaaggtgatcaatatggttca
gtctggttagcaggtcgcgcgacgtacatcaaacctcttcatctttgggacgcggactct
actgatctggtcagcttctctacgagtttcacatttgtgatcgattcgtatccaaacaat
tattatgcagatgggcttacattcttccttgctcataataattctgtgataaattcggga
ggaatcttgggtcttccattcgattctacaatccaaacaagtaaacatcgatttgtcgcg
gtggagtttgatacttatggagaaaatgattgggatccaagagatccagctactaatatt
tccataggtgaccatgtaggtatcgatatcaactctgttacttctgttgtgtctcggaaa
tggtttagcaatataacatatgggaaagagtgtagagctttgattacttataatgctgat
tctaaaaatcttagtgtttctttcactagttttaaaaataattcagttgtatgggaaact
gggcttgattacaccattgatctaaggcatgtgttgcctgaatgggtaatctttgggttt
tcggcttccactggaaatcactttgagaaaaacaatgtcgtatgttggacgtttaatagt
actgatttaaaggttgatgaaaacaaacgagaaaacaatttgttgcgtatgatgggaata
acattcggcacgttggttccagttacttgcttggctatatttgcatattttgtatggaat
aggaggacagatgatggctatgaaggagaggaacttggactgttggagatgaccaatgaa
atcgaaatgggggcatctatgcctagaaggttttcttaccaccaattagctcgggcaact
gctaactttgcagagacagagaagcttggagagggcggtttcggaggagtgtacaaaggt
tttctgaaaaatgtaaggatgtatgttgcggtaaaaatggtttcgaagacttcaaaacaa
gggatcaaagagtatgcatcggaagtaaggatcattagccgattaaggcatagaaatttg
gtgcaactcattggttggtgccatgacaaaggaaacctcctgcttgcttatgaatttatg
gaaaacggaagcttagatttacatctctttaagggaaagagcttgttgacatggaatata
aggtacaaaattgctcatggtttggcttctgctttgctatatttacatgaagaatgggag
caatgtgtattgcatagagatatcaaatcgagtaatgttatgttggacttaaatttcaat
gcgaagcttggtgatttcggtctagctaagttggttgaccatgagaaggatgcgcaaaca
acgatgttggcaggaaccttgggttatatggctcctgaatgtatagtcacgggtaaacca
accaaggaatcagatgtttttagtttcggaattgttgcattggaaatagcttgtgggcgg
agcgccattgactacaaggctcaagaaaaacaaacatggttagtagaatgggtttgggag
ctctacgggaatgacactgttttaggtgcagttgatccgagtctcgggttagaatttgaa
gaagacgaaatcagacgtttaatgatccttgggttatggtgcgtacaccctgatccagaa
tttcgtccatcaatgagacaagccattaaagtattaaactccgacgcttcactgccttca
ctaccctcaaagatgccagtggcatcttattcgacacccggagtgccctcactatccgat
ttctcttccagtgaccaataccaatccttaagtagaagtatagaacctcttagcactgat
tcatcaaagaaaacaacatcatcaacaaattcttcttattccaaatctatatcagtgttc
cattcaattcaaggaaatgtatag

DBGET integrated database retrieval system