KEGG   Helianthus annuus (common sunflower): 110930172Help
Entry
110930172         CDS       T05101                                 

Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00480  Glutathione metabolism
han00590  Arachidonic acid metabolism
han01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110930172
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110930172
Enzymes [BR:han01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     110930172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 110930172
NCBI-ProteinID: XP_022029101
AA seq 242 aa AA seqDB search
MASMPCSLNFTSPFFNFSKSNRTQFPSCLSVSCFGTSSVQSLLGSSSSGLFQHGFALKAG
IFSGFSSDSRSEFGVFATAATGKTIYDFTVKDIDRKDVPLSKFKGKVLLIVNVASQCGLT
SSNYSELTQIYNKYKDQGLEILAFPCNQFGFQEPGSNDQIKNFACTRFKAEFPIFDKIDV
NGPFTAPIYQFLKSNSGGFLGDLVKWNFEKFLVDKNGKVVERYPPTTSPLQIEKDVKKLL
AA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggcatctatgccttgctctttaaacttcacttccccatttttcaatttctctaaatcc
aaccgaacccagttcccttcttgtctctctgtttcttgctttggaactagttctgtccaa
tctcttttaggctcatcaagttcagggcttttccaacatgggtttgctcttaaagctgga
atcttttctgggttttcgtctgattctcgttctgaatttggggtttttgctacagctgcc
actggaaagactatttatgattttactgtaaaggatatcgatcgaaaggatgttcctctt
tccaaattcaagggaaaggttctacttatcgtcaatgttgcatcgcaatgtggtttgact
tcatctaactactccgagctcactcaaatatataacaagtacaaagatcaaggacttgaa
atattggcattcccttgcaatcagttcgggttccaagaacccgggtcaaatgatcagatt
aaaaattttgcttgtacaaggttcaaagccgaattcccgatctttgacaagattgatgtg
aatggcccgtttactgccccgatttatcaatttctcaagtcgaacagcggagggttcttg
ggcgatttggtgaagtggaattttgagaagtttttagtagataaaaatgggaaagtcgtt
gaaagatatcctcctactacttcccctcttcagatcgagaaggacgtaaagaaacttctt
gctgcatag

DBGET integrated database retrieval system