KEGG   Helianthus annuus (common sunflower): 110936394Help
Entry
110936394         CDS       T05101                                 

Definition
(RefSeq) coatomer subunit alpha-1-like
  KO
K05236  coatomer subunit alpha
Organism
han  Helianthus annuus (common sunflower)
Brite
KEGG Orthology (KO) [BR:han00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:han04131]
    110936394
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:han04147]
    110936394
Membrane trafficking [BR:han04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    110936394
Exosome [BR:han04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110936394
  Exosomal proteins of bladder cancer cells
   110936394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COPI_C Coatomer_WDAD WD40 ANAPC4_WD40 zinc_ribbon_9
Motif
Other DBs
NCBI-GeneID: 110936394
NCBI-ProteinID: XP_022034466
AA seq 1216 aa AA seqDB search
MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFEEHDGPVRGVHFH
QSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW
NWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDIGALKKKSVSPADDILR
LSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWE
VDTLRGHMNNVSCVLFHARQDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILGCHP
EMNLLAAGHDSGMIVFKLERERPAFAVSGESLYYVKDRFLRFYEYTSQKDTQILPIRRPG
SVSLNQGPRTLSYSPTENAILICSDVDGGSYELYIIPKDSITRGDTVQEAKRGVGGSAVF
VARNRFAVLEKSTNQVLVKNLKNEIVKKSALPSPVDAIFYAGTGNLLCRAEDRVFIFDLQ
QRLVLGDLQTSFVRYVVWSSDMESVALLSKHSIVIADKKLVHLCTLHETIRVKSGSWDDN
GVFIYTTLTHIKYCLPNGDSGIIKTLDNPVYITKIFGNTLFCLDRDGKNRPIVIDSTEYV
FKLSLLKKRYDHVMSMIRNSELCGQAMIAYLQQKGFPEVALHFVRDERTRFNLALESGNI
QIAVASAKEIDEKDHWYRLGVEALRQGNSGIVEYAYQRTKNFERLSFLYLITGNLDKLSK
MMKIAEVKNDVMGQFHNALYLGDVQERIKILINAGHLPLAYATAKTHGLNEIVEDLADKL
NGNVPNLPSGRSSSLLFPPTPVLCGGDWPLLRTMKGIFEGGLDNAGKGGNEEYEDAADAD
WGEELDIVDVENIQNGDVSMVLDDEEAPEDNEEGGWDLEDLELPPDVETPKATTSRSAVF
VTPTAGMPVSQIWVQKSSLAAEHAAAGNFDTAMRLLSRQLGIKNFTPLKSLFIDLHTGSH
SYLRAFSSAPIISLAIERGWSESASPNVRAPPALVFSFSQLEEKLKAGYKATTTGKFTEA
LRLFLSILHTIPLIVVESRREVDEVKELIIIVKEYVLGLQMELKRRELKDNPVRQQELAA
YFTHCNLQLPHLRLALMNAMTVCYKAGNLITASNFARRLLETNPTAESQTKTARSVMQAA
ERNMKDSTQLNYDFRNPFVVCGATYVPIYRGQKDVLCPYCNSHFVLSQEGQLCTVCDLAV
VGSDASGLLCSPSQIR
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atgttgacgaagtttgagacgaagagtaacagagtgaaaggtctgagttttcacagtaag
aggccatggattttagcgagtcttcacagtggtgttatccagctatgggactaccggatg
ggtactctcattgatcggtttgaggaacatgatggccccgttcgtggcgtgcactttcat
caatcacagcctcttttcgtttccggaggagatgattacaaaattaaagtatggaattac
aagctgcatcggtgtttgtttacgctgcttggccaccttgattatattcggacggttcag
tttcaccatgagaacccctggattgttagtgctagtgatgatcaaactattcggatatgg
aattggcaatctcgtacttgtatatctgttttgactggacacaaccattatgtgatgtgt
gctttgttccatccaaaggaggaccttgtggtatcagcatcattagatcagactgttcga
gtatgggatattggtgccctaaagaagaaatcagtttcacctgctgatgatatccttcgg
ctgagtcagatgaatacagatttttttggaggggttgatgctgttgtgaagtatgtatta
gagggccatgatcgaggagtcaattgggcatcattccatcccactcttcctcttattgtt
tcaggagctgacgatcgccaagtgaagatctggcgaatgaatgatacaaaagcttgggaa
gtagacacattgagaggtcacatgaataacgtatcatgtgttcttttccatgcaagacaa
gacatcatagtatctaactcggaggataaaagtatacgtgtttgggatgctacaaaaaga
accggtcttcaaactttccgtcgtgagcatgacaggttctggattctcggttgtcatccc
gagatgaacctgttggcagctggccatgacagcggtatgattgttttcaagctagaaaga
gaacgccctgctttcgctgttagtggtgaatctttgtactatgtaaaagaccgttttcta
cggttttacgagtacacttctcaaaaagacactcaaatattacctattcgcaggccaggt
tcagtcagcttgaaccagggcccaagaaccctctcttacagcccaactgaaaacgcgata
ctaatatgttcagatgtggatggcggatcttatgaactgtacatcatccctaaagatagt
attactagaggtgatacagttcaagaggcgaaacgtggtgtcggtgggtcagcggttttt
gtggcccgaaatagatttgcagttcttgagaagagcaccaatcaagtgttggtcaaaaac
ttaaaaaatgagattgtgaagaagagtgcccttccttctcccgtcgatgctatattctac
gctggtacaggtaacttgttatgtagggcagaagacagagttttcatctttgatctccaa
caacggttggttctcggggacctacaaacttcttttgtcaggtacgttgtttggtcaagc
gatatggagagtgttgccttgcttagtaagcattcaatagttatagctgataaaaaactg
gttcacctgtgcacccttcatgagacaatcagagtgaaaagcggttcatgggatgataat
ggcgtgttcatatacaccacgttaacccatattaaatactgtttgcctaatggagacagt
ggaatcattaaaacccttgataatccggtttacatcacaaaaatatttggaaacacactc
ttttgtttggatcgtgatgggaaaaaccggccaatagttattgattcaactgaatacgtc
tttaagttatctttactgaaaaagagatatgaccatgtaatgagcatgataagaaactcc
gagctgtgtgggcaagccatgattgcgtatttacaacaaaaaggtttccctgaagttgcc
ctccatttcgtgagagatgagagaacccgtttcaatctagcactagaaagtggaaacatc
cagatagctgttgcttctgctaaagagattgatgagaaagatcactggtatagattaggg
gttgaggcccttcgtcagggtaattctggcattgttgaatatgcatatcagaggacgaaa
aactttgagaggctatcttttctgtatttgataacaggaaacttggataagttgtctaaa
atgatgaagattgctgaggtgaaaaacgatgttatggggcagttccataatgctttgtat
ttgggtgatgttcaagaacggatcaagattttgatcaacgctggccatctaccactagca
tatgctacagctaagacccatgggttgaatgagattgttgaagatcttgctgataaactt
aacggtaatgttcctaatttgcccagtggtaggtcttcttctcttttgttccccccaaca
ccggtcttgtgcggtggggactggccattgttgaggaccatgaaagggatatttgagggt
ggtcttgataacgctggaaaaggtggaaacgaagagtatgaagatgctgctgatgctgat
tggggtgaggagttggatattgtggatgtggagaatattcaaaatggtgatgtcagcatg
gtgctggatgatgaagaagcacctgaagataatgaagagggaggttgggatcttgaggat
ctcgaacttcctccggatgttgaaaccccaaaagccaccactagtcgttctgctgtattt
gtaacaccgactgctggtatgcctgtgagtcagatatgggtgcagaagtcatctcttgct
gctgagcatgcagcagctggcaactttgacaccgccatgcggttactgagccgccagctt
ggtataaagaatttcacaccgctgaagtccttgttcattgatcttcacacgggaagtcat
tcttacttgcgtgcgttctcatcggctcccataatctcattggccatcgagaggggttgg
agtgagtcagcaagtcctaatgtccgggccccgcctgcactcgtgttcagtttctctcag
ttggaagaaaaactcaaggccggttacaaagccacaaccacagggaagtttactgaagcc
ttacgcctcttcttaagcattctccataccatcccactgattgttgtcgagtcaagacga
gaagtggatgaagttaaagagctgattattatcgtgaaagaatatgttttgggcttacag
atggaacttaaaaggagggaactgaaagacaacccggttcgtcaacaagaactggcggct
tatttcacgcactgcaaccttcagctaccgcacttgagacttgccttgatgaatgctatg
actgtgtgttacaaggctggtaatctgatcacagcatcaaactttgcccggaggcttttg
gagaccaacccaactgcagaaagccaaaccaaaaccgctcgttctgttatgcaggctgct
gagaggaacatgaaagattccacacaattgaattatgactttagaaacccgtttgttgtt
tgcggagcaacttatgtccctatatatcggggacagaaggatgtgttatgcccgtactgt
aattcacactttgttctttcccaggaaggccagctttgtactgtttgtgaccttgctgtg
gttggatcagatgcttcaggcttactgtgttctccatctcagatcagataa

DBGET integrated database retrieval system