KEGG   Helianthus annuus (common sunflower): 110936539Help
Entry
110936539         CDS       T05101                                 

Definition
(RefSeq) GPI transamidase component PIG-T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
han01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    110936539
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 110936539
NCBI-ProteinID: XP_022034641
AA seq 651 aa AA seqDB search
MSRFLSISILLLFVLHVSSESAGEEEFTEELLFRPLPDRKVLSHFHFESRAPPTNSYGHH
HRLFPKAIYQLVHKYRIKQMELSFTQGRWNYDSWGGFDPIASSNAKPPGVELWAVFGVPP
DQVDASWKNLTHTLSGLFCASINFLESSTAYSAPDWSFRSLSGNLRYGSLPREAVCTENL
TPWLKLLPCRDKSGLSSLMNRPSIYSGFYHSQRLHLTSDEFDPVALHGIMLEQTLTIVLQ
PDSLETHPSFSGSRKLQPSWSMSSLFGKTVDGKCALAKSSNVYVQLEGSLVYNMKNTWNS
IDSYEGDSNFGFTVSPDRMMKEINSIDKEGYSILYGFSINNDHSSKPFDLGFWWKLPVTW
SCVKAPLRVSRFLMGSGNEKGAIALSLQSTEWSQSLLKADNNGEKCNLRVDVFQLVPWYI
KVYYHTTKIYVDGASQSLGDIIEKMSVSPSEDKVSPGVMEMILRLPCDMKSASLTLEFDK
GFLHIDEYPPDANQGFDIPSAIISYPDFQTRLQYKLDTTSIKSPMVSKMQERRTILSYTE
VLLVPLTTPDFSMPYNVITITCTVFALYFGSLLNALRRRVGEEERLRKSKDKSTGKLRLL
LSKLSAKLRGKPWEPPSSTPPSSSSKFISTKVVIKIILIAAIAFGWQYYDG
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgttttctatcaatctccatattactgttattcgtactccacgtttcctctgaa
tccgccggagaagaagaattcacggaggagctgttgttccggccgcttcctgatcggaaa
gttctttcgcattttcacttcgagagtagagctccgcctacaaattcgtatggacatcac
caccggctttttcccaaagctatttatcagctggttcacaaataccgaataaaacaaatg
gaattatctttcactcaaggtcgttggaactacgacagctggggtggttttgaccctatt
gcaagcagcaacgccaaacctcctggagtcgaattatgggctgttttcggtgttcctcca
gatcaggttgacgcttcttggaaaaacctaacacacacactttcaggccttttttgtgct
tcaatcaactttctagaatcttccaccgcctattctgctcctgattggagctttcgctca
ctttcaggaaatttacgatacggttcattacctcgagaggctgtctgcaccgagaatctg
actccgtggttaaaattacttccatgccgagacaaatctgggctttcctcattaatgaac
agaccgtcaatttacagtggattttatcattctcaacggttacatttaacttccgatgag
tttgatccagtggctttgcatggaatcatgcttgaacaaaccctcacaattgttcttcaa
ccagattctttggaaactcacccttcattctctggcagtagaaaattacaaccgagctgg
agtatgagttcattattcggaaaaacggttgatggaaaatgcgctcttgctaagtctagt
aacgtttacgttcaacttgaggggagcttggtttataacatgaaaaacacatggaacagt
attgacagttacgagggtgattcaaactttggatttactgtttctccagacagaatgatg
aaagaaattaacagtatcgataaagaaggctattctatcttatatggtttctcaattaat
aatgaccatagctctaaaccgtttgatttgggattctggtggaagcttccggtaacttgg
tcatgtgtgaaggcgccattacgtgtaagtcggtttctaatgggaagtgggaatgagaag
ggtgctattgctctctctttgcagtcaacagaatggagtcagagcctcttaaaagccgac
aacaatggagaaaaatgtaacttgcgggtagatgtttttcaacttgtgccttggtatata
aaagtatattatcataccacaaagatatatgtcgatggggcatcacaatctcttggagat
atcattgaaaagatgagtgtctcaccgtctgaagataaggtgtcccctggagtaatggaa
atgatcttaagattaccttgtgacatgaaatcagcttcattaactttagaatttgacaag
ggtttcttgcacatagatgagtatcctccggatgctaaccaagggtttgacatcccgtct
gctataatcagctacccggatttccagacacgcttacagtataaactggataccacttcg
attaagtcacctatggtgtcaaagatgcaggaaagaagaacaatactgtcttacacagaa
gtgcttcttgttcctttgacaacccctgattttagcatgccttacaatgtaatcacgatc
acatgcactgtctttgcgttatattttgggtcgttattaaatgcattgagaaggcgtgtt
ggcgaggaagaaagacttaggaaaagcaaagataaaagtactggtaagctccgattgctg
ttatccaagttgtcagctaagttgagaggaaaaccttgggaaccaccgtcatcaacgcca
ccatcttcatcctctaaattcataagcacaaaggtagttataaaaatcatattaatagcc
gccattgctttcgggtggcagtattatgatgggtga

DBGET integrated database retrieval system