KEGG   Helianthus annuus (common sunflower): 110939634Help
Entry
110939634         CDS       T05101                                 

Definition
(RefSeq) tRNA wybutosine-synthesizing protein 2/3/4-like
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
han  Helianthus annuus (common sunflower)
Brite
KEGG Orthology (KO) [BR:han00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:han03016]
    110939634
Enzymes [BR:han01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     110939634
Transfer RNA biogenesis [BR:han03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    110939634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3 Met_10 Kelch_3 Kelch_4 Kelch_5 Kelch_6 Kelch_1 Kelch_2 MTS DNA_methylase Methyltransf_15 Methyltransf_25 Cons_hypoth95 PrmA TRM
Motif
Other DBs
NCBI-GeneID: 110939634
NCBI-ProteinID: XP_022036902
AA seq 1000 aa AA seqDB search
MEFEKRKKATLATMTSSEPDKSPKGDIDTPLIPLLQTLNSHPSYFTTSSCSGRISILSTP
TAAATTAVKKKAKGGTWVFITHEPADPFSVQNLIFPPNPTQNDIQENLVFRFEPLIIAVE
CKDVLSAQKLVSLAISCGFRESGITNVSSKRVIVAIRCSIRLEVPLGETCKIMVSKEYLN
YLVGIANEKMEANRKRTDSFHDALLRNEFIARPEISTGSGDCEFLNLNQDLGDKDCSMVT
AGLEDIQLTSEIKDGASNGVPELPIKPMVITGEPVEKLHLWGHSACTLETTKNPKSVFVF
GGFGGVGRHARRKDSWLLDSVSGQLQLVDFSSTPSPRLGHTASLAGELMFVIGGRADPGN
VLNDVWVLNTTNNDWKQVLCTGIGFPHSHRHASAVIGSSLYVFGGIQNGSISSGMYRLDT
QNLTWEEVVVQGQIPSPRHSHTLVAHGAQLFMFGGYDGSKALGDFYSFDIHSCTWKKEKM
VGSTPYARFSHAMFVYKNYIGVMGGCPIKQHYQELSVLKVGSSVWKRIKLSSVGEDLFVR
STTSVVGDDLVIVGGGASCYAFGTKFSEPMKLNLLSLVSFAEPFNETEDQSNIDLKTMVP
LRWVLRVDKKHAKPAKDILKKFGWLDAERKVYTQENGVHVCFPITKEFVALYQNKKPDIN
GVVNEVSNLNLQEILKVVSSARALDLLAALGATTHADHIVKVKKASSSPLKVMKDAVASL
LNRHNLPTTLLEQLPTRWERLGDIVVLPMTSFKDSVWDTLGKELWLTVADSLGATRLARQ
GKVSPTGTRDSGLEILVGVNGWVDHRENGVLYSFDATKCMFSWGNLSEKRRMGQLDCKQE
VIVDLFAGIGYFTLPFLVKANAKMVYACEWNPHAIEALRRNLEANGVADRCVVLEGDNRA
TAPKGVADRVNLGLLPSSEGSWITAVKALRSEGGMMHVHGNVKDSEEDSWTEQVSKSIKE
ISRSEGYNWDVSVEHVERVKWYAPHIRHLVVDIKCKQIDS
NT seq 3003 nt NT seq  +upstreamnt  +downstreamnt
atggagtttgagaagagaaagaaagccactttggccaccatgacttcttcagaacctgac
aaatcaccaaaaggagacatagacacacctctaatcccacttcttcaaaccctcaactct
cacccttcttacttcaccaccagttcttgctccggccgcatctccatcctctccacccca
accgccgccgcaaccaccgccgtcaagaagaaagccaaaggtggcacatgggtcttcatc
acccatgaaccagctgaccctttttcggttcaaaatctcatctttcctccaaacccaact
cagaatgacattcaagaaaatcttgttttcagatttgaacctttgatcattgctgttgaa
tgtaaagatgtcttgtctgctcaaaagttggtgtctttagctatttcatgtgggtttaga
gaatcagggattacaaatgtcagtagtaagagagtgattgtggcgattcgatgttcgatt
aggttagaagtgcctttgggagagacttgtaagatcatggtgtcaaaggagtatttgaat
tatcttgttgggattgctaatgagaaaatggaagctaataggaaaagaactgatagtttt
catgatgcattgttgaggaatgagtttattgctcgacccgaaatcagtacggggagtggt
gattgtgagttcctaaacttgaatcaagatttgggtgataaagattgctcaatggttact
gctgggttggaagatattcaacttacaagtgaaatcaaagatggcgcaagtaatggagtt
cctgagcttcctataaaaccgatggttatcactggtgaaccagttgagaagcttcatctt
tggggccattcagcctgtacgcttgaaactacaaaaaatcccaaatcagtgtttgtgttt
ggtggttttggaggcgtaggaaggcatgcaaggagaaaagattcatggcttctggattca
gtatctggtcaacttcagttagttgacttttcaagcaccccatccccgcgtttgggtcac
acagcttctttagcaggagagcttatgtttgttataggaggtagagccgatcctgggaat
gtgctaaacgatgtttgggttcttaatacgacaaataacgactggaaacaggtactgtgt
accggaattggatttcctcacagtcatcgacatgcatcggcagtaattgggtcaagcctc
tatgtttttggcgggattcagaatggcagcatctcgtcaggaatgtacaggcttgatacg
caaaacttaacatgggaagaagtagttgttcaagggcaaataccgtcacctcgtcattct
cacacattggtagcccacggtgctcaactatttatgtttggaggatatgatgggtcgaaa
gcacttggagatttctacagttttgacattcattcatgcacttggaagaaagaaaagatg
gtgggaagtacaccgtatgcacggttttcccacgccatgtttgtgtataaaaactatatt
ggtgtcatgggagggtgtcctatcaaacaacactatcaagagttgtcagtactcaaagtg
gggtccagtgtatggaagcgtatcaagttgagttccgttggtgaagacctttttgttcgt
tcgacaacgagtgttgttggtgatgatcttgttattgtaggtggtggtgcttcttgttat
gcgtttggaactaagtttagtgaaccgatgaaactaaacttgctttcgttagtttctttc
gctgaaccttttaatgagaccgaggaccaatcaaatattgatttaaaaacaatggtgcct
ttgcgttgggttctacgagttgataaaaagcatgcgaagcccgcaaaagatatattaaag
aaatttggatggttagatgcagagagaaaagtatacacgcaagaaaatggagttcatgtt
tgttttccgatcaccaaagaatttgtggcactttaccaaaataagaaaccagacataaat
ggagtcgtaaacgaggtaagtaaccttaatttgcaagaaatcttgaaggttgtttcaagt
gcaagggccttggatcttttggctgcattaggtgcaaccacacatgctgaccatatcgtc
aaagttaaaaaagcttcaagttctcctttgaaagtaatgaaagatgcggttgcttctttg
ttaaatcgtcacaatctgcctacaacactcttggaacaactacccacgagatgggagcga
ttaggtgacattgttgtgcttcccatgacttcttttaaggactcggtttgggacacgcta
ggaaaggagctttggttgactgttgctgactcacttggcgccactcgccttgctcgacaa
ggaaaggtttcacctaccggaacgagagatagtgggctggagattctagttggggtcaac
ggatgggttgaccatcgggaaaatggagttctttactcgtttgatgctaccaaatgcatg
ttttcatggggtaatctctctgagaagcgtagaatggggcagcttgactgcaaacaggaa
gttattgttgacttgtttgctggcattggatacttcacgttgccgtttctagtcaaggct
aatgcaaaaatggtgtatgcttgtgaatggaatccccatgctatagaggctctcaggcgt
aatcttgaagcaaatggtgtggctgatcgttgcgttgttctcgaaggagataaccgtgcc
acagcacctaaaggagttgccgatcgagtcaatcttggtctgttaccatcaagcgagggt
agttggattactgctgtaaaggcattacggagcgagggtgggatgatgcatgtgcatgga
aacgtgaaggactctgaagaggattcgtggacagaacaagtctcaaaatcaattaaagaa
atttcacgatccgaaggttataattgggatgtatctgttgagcatgtagaaagagtaaag
tggtatgcacctcacattcgccatcttgtagtagacataaaatgcaaacaaattgactca
taa

DBGET integrated database retrieval system