KEGG   Helianthus annuus (common sunflower): 110941775Help
Entry
110941775         CDS       T05101                                 

Definition
(RefSeq) uncharacterized protein LOC110941775
  KO
K06195  ApaG protein
Organism
han  Helianthus annuus (common sunflower)
Brite
KEGG Orthology (KO) [BR:han00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    110941775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 UVR DUF4354 CBM49
Motif
Other DBs
NCBI-GeneID: 110941775
NCBI-ProteinID: XP_022039131
AA seq 285 aa AA seqDB search
MHSVTLKPFTQFNTVKSTHTTPLQSPFGAKNLPLRLNCVHHRRNCRITARAAETDGGAGA
GAESQSQSNSSSSFARNQTYALLKQQMELAAKSEDYEEAARLRDSLKLFEEEEPVLRLRG
LMKEAIANERFEDAARYRDQIKEIAPHYLLKCSSDATTLGIRVQVRSVYIEGRSQPLRDQ
YFFAYRIRITNNSNRPVQLLKRHWIITNANEKSEDVWGIGVIGEQPVILPNNSFEYSSAC
PLTTPSGRMEGDYEMKHIDKVGSKTFNVAVAPFALSTLGDATDNI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcattccgtaaccttaaaaccgtttactcaattcaacaccgttaaatcaacgcacaca
acaccacttcaatcaccttttggcgccaaaaatcttccacttaggttaaattgtgtacat
caccggagaaattgcagaataaccgctcgtgcggcggagacagacggcggcgccggtgcc
ggagcagagagtcagagtcaatcgaattcgagttcgtcgtttgctcggaatcaaacttat
gctttgctgaagcaacaaatggaacttgcagctaaatctgaggattatgaagaggctgct
aggcttcgcgattcgttgaagttgtttgaagaggaggagccggttttacggcttcgaggt
ttgatgaaagaagctattgccaatgagaggtttgaggatgcagcaagataccgtgatcag
ataaaagaaattgctcctcactatctactgaagtgttcaagtgatgcaacaacattggga
atcagggttcaagttaggagtgtgtacattgaagggcgcagtcaacctttgagagaccaa
tatttctttgcataccggatacgaataactaataattcaaaccgacctgtacaacttctc
aagagacactggataatcaccaatgctaatgagaaatctgaggatgtttggggtattgga
gttatcggtgaacaaccagttatacttcctaataacagtttcgaatattcatcagcatgc
ccattaaccactcctagtggaagaatggaaggtgactatgaaatgaagcatattgataag
gtagggtcaaagacgtttaacgtggctgttgccccctttgctctttcaacattaggggat
gctacagacaacatttga

DBGET integrated database retrieval system