KEGG   Helianthus annuus (common sunflower): 110942161Help
Entry
110942161         CDS       T05101                                 

Definition
(RefSeq) farnesyl pyrophosphate synthase 1
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
han  Helianthus annuus (common sunflower)
Pathway
han00900  Terpenoid backbone biosynthesis
han01100  Metabolic pathways
han01110  Biosynthesis of secondary metabolites
Module
han_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:han00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    110942161
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:han01006]
    110942161
Enzymes [BR:han01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     110942161
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     110942161
Prenyltransferases [BR:han01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   110942161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt Ldh_1_C
Motif
Other DBs
NCBI-GeneID: 110942161
NCBI-ProteinID: XP_022039590
AA seq 247 aa AA seqDB search
MDESHTRRGQPCWFRLPKVGMIAANDGIILRNHIPRILKKHFRGKPYYVDLLDLFNEVEF
QTASGQMIDLITTLVGEKDLSKYSLSIHRRIVQYKTAYYSFYLPVACALLMSGEDLDKHE
EVKNVLVEMGTYFQVQDDYLDCFGAPEVIGKIGTDIEDFKCSWLVVKALELSNEEQKKFL
HENYGKKDPSSVAKVKELYHTLNLQGVFEEYENASYKKLITSIEGHPSKAVQAVLKSFLG
KIYKRQK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggatgagtctcatacacgcagaggtcaaccctgttggttcagactacccaaggttggt
atgattgctgcaaatgatggtataattcttcgtaaccatataccaagaattctcaagaaa
catttccgaggaaagccttattatgtggatctactggacctgttcaatgaggtagaattt
caaacagcctctggacaaatgatagatttgattactacacttgttggagagaaggatcta
tcgaagtattcattgtctattcaccgccggattgttcagtataaaactgcttactactca
ttttatcttccagtggcctgtgcactccttatgtctggtgaggatttggacaaacacgag
gaagtgaagaacgtacttgttgaaatgggtacctattttcaagtgcaggacgattatcta
gactgtttcggtgctcctgaggttattggaaagattggaacagacattgaagactttaag
tgctcctggttagttgtgaaagctttggaactttccaatgaggaacaaaagaaattccta
catgagaactatgggaaaaaagatccctcttcagttgcaaaggtgaaggaactataccac
actctaaatcttcagggtgtattcgaagagtatgagaacgcaagctacaagaagctgatc
acttccatcgaaggtcatccaagcaaagcggtgcaagcggtgttgaaatctttcttagga
aagatatacaagaggcaaaagtag

DBGET integrated database retrieval system