KEGG   Halothece sp. PCC 7418: PCC7418_0655Help
Entry
PCC7418_0655      CDS       T02379                                 

Definition
(GenBank) photosystem II D2 protein (photosystem q(a) protein)
  KO
K02706  photosystem II P680 reaction center D2 protein [EC:1.10.3.9]
Organism
hao  Halothece sp. PCC 7418
Pathway
hao00195  Photosynthesis
hao01100  Metabolic pathways
Module
hao_M00161  Photosystem II
hao_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:hao00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    PCC7418_0655
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:hao00194]
    PCC7418_0655
Enzymes [BR:hao01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.9  photosystem II
     PCC7418_0655
Photosynthesis proteins [BR:hao00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Main subunits
    PCC7418_0655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Photo_RC
Motif
Other DBs
NCBI-ProteinID: AFZ42878
UniProt: K9YDJ4
Position
732339..733400
Genome map
AA seq 353 aa AA seqDB search
MTIAVGRAQQQRGVFDLVDDWLKRDRFVFIGWSGLLLFPCAYMAIGGWLTGTTFVTSWYT
HGLASSYLEGCNFLTVAVSTPADAFGHSLLFLWGPEANWDFVRWCQIGGLWSFVALHGAF
GLIGFMLRQFEIARLVGVRPYNAIAFSGPIAVFVSVFLMYPLGQSSWFFAPSFGVAGIFR
FILFFQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFDEGGDSNNTFRAFEPTQ
AEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAVGVVGLGLNLRAYDFV
SQEIRAAEDPEFETFYTKNILLNEGLRAWMAPDDQPHEQFEFPEEVLPRGNAL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgcagtaggacgcgcccaacaacaaagaggagtcttcgacctcgtcgatgac
tggctcaagcgcgacagatttgtctttatcggctggtctggtttactgctgttcccctgc
gcttacatggcaatcgggggatggctcaccggaaccacctttgtcacctcctggtacact
cacggtttagcaagctcttatctggaaggctgcaacttcttaaccgttgccgtttccacc
cccgcagacgctttcggacactccctgctcttcttatggggaccagaagcgaactgggac
tttgtacgctggtgtcaaatcggcggactctggagtttcgtcgccctccacggtgcattt
ggactgattggcttcatgctgcgtcagtttgaaattgcccgtttggtcggtgtacgtcct
tacaacgcgatcgcgttctccggtccgattgctgtatttgtcagcgtcttcttaatgtat
cctttaggacagtcaagctggttctttgcgcccagttttggtgtcgcaggaatcttccgc
ttcattctgttcttccaaggattccacaactggactctcaatcccttccacatgatgggg
gttgctggaatcttaggcggtgcattactctgtgcgattcatggcgcaaccgtcgaaaac
accctgtttgatgaagggggcgacagcaacaacaccttccgcgcctttgaacccactcag
gcggaagaaacctactccatggtgaccgcaaaccggttctggagtcagatcttcgggatt
gcgttctctaacaaacgctggttacacttcttcatgctgtttgttccagtaacaggactg
tggatgtccgcagttggagttgtgggcttaggtctcaacctgcgtgcgtatgactttgtg
tctcaagagattcgcgcagcagaagatcctgagtttgaaaccttctatacgaaaaacatc
ttattaaacgaaggtctccgcgcctggatggccccggatgaccaaccccacgaacagttt
gaattccctgaagaagtcttacctcgcggtaacgctctctaa

DBGET integrated database retrieval system