KEGG   Halothece sp. PCC 7418: PCC7418_1887Help
Entry
PCC7418_1887      CDS       T02379                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
hao  Halothece sp. PCC 7418
Pathway
hao00310  Lysine degradation
hao01100  Metabolic pathways
hao01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hao00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    PCC7418_1887
Enzymes [BR:hao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     PCC7418_1887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_3 NAD_binding_8 Pyr_redox_2 Mqo HI0933_like NAD_binding_9 FAD_binding_3 FAD_binding_2 Trp_halogenase Thi4 Lycopene_cycl Ntox6 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AFZ44055
UniProt: K9YCC6
Position
complement(2065183..2066397)
Genome map
AA seq 404 aa AA seqDB search
MIYDQVIIGGGIVGLATAMQLAQKSPKARILLLEKETDLAAHQTSHNSGVIHSGIYYKPG
SFKAKFCRDGSRSMVEFCQEHNLDYEVCGKVIIATQEQELPRLERLYQRGLENGISVKKL
RGEAIQELEPHVRCLAGIRVNSTGITDYKKVCQKYAQILRDRAGELKFNTQVTQLQKTAD
GYVIETNQGDFQAKFIINCAGLHSDRVAKLGAVNPQAKIIPFRGEYYELKPEKRYLVKNL
IYPVPNPNFPFLGVHFTRMIDGSVHAGPNAVLSFKREGYQKTDWDRRDLIESLTYPGLWK
LAAKYGAIGVAEMIRSWSKTAFVRSLQRLIPEIQPEDVIPISAGVRAQALKQNGALVDDF
LMIEGRKALHICNAPSPAATASLEIGKAIADRVLAMEMTVQTCS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgatcaagtcattattggcggtggcattgttggactcgcgactgctatgcaa
ttagctcaaaaaagtccgaaggctcgcattctcctgttagaaaaagagactgatttggct
gctcatcaaaccagtcataacagtggggttattcattctggaatttattataagccaggt
agctttaaggctaaattttgtcgcgatggcagtcgttccatggtggaattttgtcaggaa
cataatcttgattatgaggtttgtggaaaggtcattattgccactcaggaacaagaatta
ccgcgactggaaaggctctatcaaagaggactggaaaatggcatttcggtaaaaaaactc
aggggggaagcgatacaagaacttgaacctcatgtgcgttgtcttgctggaattcgggtg
aattcaacgggcattacagattataaaaaagtttgccaaaagtatgctcaaattttgcgc
gatcgcgcgggagaattaaaatttaatacacaagttacccagcttcaaaaaactgctgat
ggttacgtcattgaaaccaatcaaggagattttcaagccaagtttattattaactgtgct
ggcttacacagcgatcgcgtggcaaaattaggggctgtgaatccccaagcgaaaattatt
ccctttcgcggtgaatactatgaattgaaaccagaaaaacgttatttagtgaaaaactta
atttatccagtcccgaatcctaactttccttttctgggtgtgcatttcacgagaatgatt
gatggtagtgttcacgccggccccaatgccgtgctaagtttcaagcgagaaggatatcaa
aaaacggattgggatcgacgggatttaatagaaagtttgacttatcctggattatggaaa
ttagcagcaaaatatggggcgattggtgttgcagaaatgattcgttcttggagtaaaact
gcctttgttcgcagtttacaacgcctaattccagaaatccaaccagaagatgtgattccg
atttcggcgggggttcgtgcccaagcgttaaagcaaaacggtgcgttagtggatgatttt
ttaatgattgaaggtcgcaaggcgttacacatttgtaacgcgccctctcccgcagccact
gcttctctagaaattggtaaagcaattgccgatcgcgttttggcaatggaaatgactgtt
caaacttgcagttga

DBGET integrated database retrieval system