KEGG   Halothece sp. PCC 7418: PCC7418_2959Help
Entry
PCC7418_2959      CDS       T02379                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
hao  Halothece sp. PCC 7418
Pathway
hao00010  Glycolysis / Gluconeogenesis
hao00071  Fatty acid degradation
hao00350  Tyrosine metabolism
hao00625  Chloroalkane and chloroalkene degradation
hao00626  Naphthalene degradation
hao01100  Metabolic pathways
hao01110  Biosynthesis of secondary metabolites
hao01120  Microbial metabolism in diverse environments
hao01130  Biosynthesis of antibiotics
hao01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7418_2959
  Lipid metabolism
   00071 Fatty acid degradation
    PCC7418_2959
  Amino acid metabolism
   00350 Tyrosine metabolism
    PCC7418_2959
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PCC7418_2959
   00626 Naphthalene degradation
    PCC7418_2959
Enzymes [BR:hao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PCC7418_2959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C NAD_binding_10 adh_short
Motif
Other DBs
NCBI-ProteinID: AFZ45088
UniProt: K9YG76
Position
3214998..3216023
Genome map
AA seq 341 aa AA seqDB search
MANTMKAAIAEEFGKPLQLKEVEIPQPQAEQVLVKLAVSGVCHTDVHAADGDWPVKPNIP
FIPGHEGVGHVAEVGSHVTHLEKGDHVGIPWLHTACSRCEYCVTGQENFCPTQENTGYSV
NGTFAEYVLADANHATKIPQPLESTDAAPILCAGVTTYRGLKETHTKPGDWVVISGIGGL
GHLAVQYAKAMGLRVIALSRTPKKLELAQELGADKTINVSETDPGQAVQDQIGGAHGALV
TAVSTQAFHQAVSTLQRSGTCSMVGLPPGEFPLSIFEVILKGIDIQGSLVGTRADLREAL
QFAAEGHVKPAIETQPLEAVNATMERLKKGEVNGRVVLTMS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacaccatgaaagctgcaatcgcagaagagtttggcaaaccgctacaactcaag
gaagtagaaattccgcaacctcaagcggaacaagttctagtcaaacttgcagtcagtgga
gtttgccatacagatgtccatgctgctgatggtgactggccagtgaagccgaatattccg
tttattccgggtcatgaaggcgtaggtcatgttgctgaagtgggctcccatgtcactcat
ttagaaaaaggagatcatgtagggattccttggctacatacagcttgttctcggtgtgaa
tattgtgtcactggacaagaaaatttctgcccaactcaagaaaataccggctatagtgtg
aatggaacatttgccgagtatgttctagcggatgcgaatcatgccacgaaaattcctcag
cctctagagtcaacggacgctgcgccaattttatgtgcaggagtaaccacctatcggggt
ctgaaagaaacccataccaaaccgggagattgggttgtgatttctggtattggtggactg
ggacatttagccgtgcaatatgccaaagccatggggcttcgtgtgattgccttatcccgg
actcccaaaaaactagaactggctcaagaattgggagcagacaaaacaattaatgtgagc
gaaacagatccgggtcaagcggttcaagatcagattgggggagctcatggcgcactggta
actgccgtttccacacaagcctttcatcaagcagtgagtaccttacaacgcagtggtact
tgttccatggttggtttacccccaggagagtttccgctttccatctttgaggtcattttg
aaaggcattgatattcaagggtctctggttggcactcgtgctgatttacgggaagccctt
caatttgcagccgaaggtcatgtgaagcctgcaattgaaactcaacccttagaagcagtt
aacgcgactatggaacgtctgaaaaaaggagaagttaatgggcgtgttgtcttaaccatg
tcataa

DBGET integrated database retrieval system