KEGG   Glaesserella parasuis SH0165: HAPS_0155
Entry
HAPS_0155         CDS       T00825                                 

Symbol
pflB
Name
(GenBank) pyruvate-formate lyase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
hap  Glaesserella parasuis SH0165
Pathway
hap00620  Pyruvate metabolism
hap00640  Propanoate metabolism
hap00650  Butanoate metabolism
hap01100  Metabolic pathways
hap01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HAPS_0155 (pflB)
   00640 Propanoate metabolism
    HAPS_0155 (pflB)
   00650 Butanoate metabolism
    HAPS_0155 (pflB)
Enzymes [BR:hap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     HAPS_0155 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ACL31851
UniProt: B8F3E9
Position
170089..172413
AA seq 774 aa
MTQLTEAQKKAWEGFAPGEWQTDVNVRDFIQKNYTPYEGDESFLADVTEATTTLWADVME
KIKVENKTHEPYDIDCDIPSTITSHAPGYINKDLEKIVGLQTDAPLKRAIMPFGGINMVK
GSCKVYRRELNPEVEKIFTEYRKTHNQGVFDVYTPDILRCRKSGVITGLPDAYGRGRIIG
DYRRMALYGADFLMKDKVKQFTSLQEQLERGEDIQATIQLREEIAEQHRALGKMKEMAAS
YGFDISNPATNAQEAVQWVYFAYLAAVKSQNGAAMSFGRVSTFLDIYIERDLKAGKITEK
EAQELMDHLVMKLRMVRFLRTPEYDQLFSGDPMWATETFAGMGLDGRTLVTKNSFRLLHT
LYTMGPSPEPNLTILWSESLPDGFKRYAAKVSIETSSVQYENDDLMRPDFQNDDYAIACC
VSPMIVGKMMQFFGARANLAKTLLYAINGGVDEKSGDQVGPKTEPIMSEYLDYDDVMTRL
DSFMDWLAKQYVTALNIIHFMHDKYAYEAALMALHDRDVFRTMACGIAGLSVAADSLSAI
KYAKVKPIRGDIEIKNKAGEVVGVAKNVALDFEIEGEYPQFGNNDNRVDDIAVDLVERFM
KKIQKLKTYRNATPTQSVLTITSNVVYGKKTGNTPDGRRSGAPFGPGANPMHGRDQKGAV
ASLTSVAKLPFAYAKDGISYTFSIVPNALGKDLESQKRNLAGLMDGYFHHESTIEGGQHL
NVNVMNREMLLDAMENPEKYPQLTIRVSGYAVRFNSLTKEQQMDVITRTFTQSM
NT seq 2325 nt   +upstreamnt  +downstreamnt
atgactcaactaaccgaagctcaaaagaaagcgtgggaaggttttgcaccaggtgaatgg
caaactgatgtaaacgtgcgtgactttatccaaaaaaactatacgccgtatgaaggtgac
gaatctttcttagcagatgtaaccgaagcaactacaacgctttgggcagatgtgatggaa
aaaatcaaagtggaaaacaaaacccacgaaccgtatgacattgattgcgatattccatca
accatcacttcacacgcaccaggttatatcaacaaagatttagagaaaatagtaggtctt
caaacagatgcaccattaaaacgtgcaattatgccgtttggcggtatcaatatggtgaaa
ggctcttgtaaagtttatcgccgtgaattaaatccagaagtagagaaaatctttactgaa
tatcgtaaaacccacaaccaaggtgtattcgatgtttatactccagacattttacgttgc
cgtaaatcaggcgtaattacaggtcttcctgatgcttacggtcgtggtcgtattatcggt
gactatcgtcgtatggctctttacggtgctgacttcttaatgaaagataaagtaaaacag
tttacctctttacaagagcagttagagcgtggcgaagatattcaagcgacaatccaatta
cgcgaagaaattgcagaacaacaccgtgctttaggcaaaatgaaagaaatggcagcatct
tatggctttgacatttcaaacccagcaactaacgcacaagaagcggtacaatgggtttac
tttgcttaccttgcagcagtgaaatcacaaaacggtgcagcaatgtctttcggtcgtgtt
tcaaccttcttagatatttatattgaacgtgacctaaaagcaggcaaaatcactgaaaaa
gaagctcaagaattaatggatcacttagtaatgaaactccgtatggttcgtttcttacgt
accccagagtacgatcaattattctcaggcgacccaatgtgggcaacagaaactttcgca
ggtatgggcttagatggtcgtacattagtaaccaaaaacagcttccgtctattacacacc
ctttacacaatgggtccatcaccggaaccaaacttaacaatcctttggtctgaaagttta
ccagatggtttcaaacgctatgcagcgaaagtgtctatcgaaacttcatctgttcagtac
gaaaatgacgacttaatgcgtccagatttccaaaacgatgactatgcgattgcctgctgt
gtaagcccgatgatcgtaggtaaaatgatgcagttcttcggtgctcgtgcaaacttagcg
aaaaccttactatacgcaatcaatggcggtgtggatgagaaatcaggtgaccaagttgga
ccgaaaactgagccaattatgtctgaatacttagattacgatgatgtaatgacccgttta
gacagctttatggactggttagcgaaacaatatgtcacagcgttaaacatcattcacttt
atgcacgacaaatatgcttatgaagcagcattaatggcgttgcacgatcgtgatgtattc
cgcacaatggcgtgtggtatcgctggtctttctgttgcagcagactcactctctgcaatc
aaatatgcgaaagtaaaaccaatccgtggcgacatcgaaatcaaaaataaagcaggcgaa
gtggttggcgtagcgaaaaacgtagcacttgactttgaaattgaaggtgaatacccacaa
ttcggtaacaacgataaccgtgtagatgacattgcagttgatttagttgaacgctttatg
aagaaaattcagaagctcaaaacataccgtaatgcaactccaacacagtcagtattaacc
attacttcaaacgtggtttacggtaagaaaacaggtaacaccccagacggtcgtcgttca
ggtgcgccattcggaccaggtgcaaacccaatgcacggacgtgaccaaaaaggtgcggta
gcgtcattgacttctgtggcgaaattaccatttgcttacgcgaaagatggtatctcttat
accttctcaatcgtaccaaatgcgttaggtaaagatcttgaatctcaaaaacgtaacctt
gcaggcttaatggacggttacttccaccacgaatcaaccatcgaaggtggtcagcactta
aacgtaaacgtaatgaaccgtgaaatgttattagatgcgatggaaaatccagagaagtat
ccacaattaacaatccgtgtttcaggctacgcagtgcgtttcaactctttaactaaagag
caacaaatggacgtaattactcgtactttcacacagtcgatgtaa

DBGET integrated database retrieval system