KEGG   Glaesserella parasuis SH0165: HAPS_0613Help
Entry
HAPS_0613         CDS       T00825                                 

Definition
(GenBank) glycoside hydrolase family protein/phage lysozyme
  KO
K01185  lysozyme [EC:3.2.1.17]
Organism
hap  Glaesserella parasuis SH0165
Brite
Enzymes [BR:hap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     HAPS_0613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_lysozyme
Motif
Other DBs
NCBI-ProteinID: ACL32266
UniProt: B8F4L4
Position
complement(633067..633612)
Genome map
AA seq 181 aa AA seqDB search
MSKLRKLGKFGGGVCFVSAIIAVLNTDFHGQFRTSKQGLEIIGDAEGCKREPYLCPANVL
TVGIGSTEASSGKIERKVYTDKEIAQRWLVDIQHAEKCVKRYANGGDIPQSVFDAATSLT
FNAGCGTVSKSTFFRKIKSGDYVGACNELPKWVYSGGKKLRGLEIRREKEKALCLAGLIK
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctaagaaaactgggtaaatttggcggtggggtttgttttgtcagtgccatt
attgcggtgttgaatacagattttcacggtcaatttcgtacaagtaagcaagggcttgaa
attattggcgatgcagaaggttgtaaacgagaaccttatttgtgtcctgcaaatgtgctt
actgttggtattggttcaacggaagcgtcaagcggtaagattgaaagaaaagtttacacg
gacaaagagattgcacagcgttggttggttgatattcagcacgcagaaaaatgtgtgaag
cgttacgcaaacggtggtgatattccgcaatcggtatttgatgccgctacttcgctgacg
tttaatgctgggtgtggcaccgtgagtaaatcgacgttctttcgtaaaatcaaatcaggc
gattatgttggtgcctgtaatgagttgcctaaatgggtttattcaggaggcaagaagtta
cgagggttagaaatccgtcgtgagaaagagaaggcgttatgtttagctgggttaataaaa
tcttaa

DBGET integrated database retrieval system