KEGG   Glaesserella parasuis SH0165: HAPS_1561Help
Entry
HAPS_1561         CDS       T00825                                 

Gene name
bioF
Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
hap  Glaesserella parasuis SH0165
Pathway
hap00780  Biotin metabolism
hap01100  Metabolic pathways
Module
hap_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:hap00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HAPS_1561 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hap01007]
    HAPS_1561 (bioF)
Enzymes [BR:hap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     HAPS_1561 (bioF)
Amino acid related enzymes [BR:hap01007]
 Aminotransferase (transaminase)
  Class II
   HAPS_1561 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ACL33115
UniProt: B8F713
Position
1541893..1543035
Genome map
AA seq 380 aa AA seqDB search
MNKFTQHLQQLAEIGQKRQLPDIEHQGKFVIARDLTMLNLSSNDYLGLANDAQQVERFLQ
SIGKNQPLTSSSSRLLTGNFPIYQDFETLLAQRFQRESALLFNSGYHANIGILPAVADKQ
TLILADKLAHASLIDGIRLSGADFFRYKHNDYLHLEQLLQTHSERYQQVIIVTESVFSMD
GDIADLQQLVALKKRYTNVLLYVDEAHAIGVYGQQGLGMAEVFDCIQEIDFLVGTFGKAL
ASMGAYLVCDSEIREYLINTMRPLIFSTALPPINVAWTYFLFEQLPQFTEKRHHLEKLSQ
ILRTEVTKRSEFPLLSETCIVPYILGENQQAVEKADYLQKQGYYCLPIRPPTVPKGTARL
RFSLTADLTEQDIMGLISCL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgaataaatttactcaacatcttcagcaattagctgaaattgggcagaagcgccaactc
cctgatattgaacatcagggaaaatttgttattgctcgtgatctgacgatgttgaattta
tcgtctaacgattatttgggtttggcaaatgatgcacaacaggtggaaagatttttgcaa
tctatcggtaaaaatcaaccgcttacgtcatcatcttctcgtttattaacaggcaatttc
ccgatttatcaggattttgaaacgctattagcacaacgttttcagcgagaatccgctcta
ttatttaatagcggctatcacgccaatatcggtattttgcctgcggtggcggataaacaa
actttaattttagctgacaaattggctcatgccagtttgattgacggcattcgactttcc
ggggcggattttttccgttataagcataatgattatcttcatcttgagcagctattgcag
acacattcagagcgctaccaacaagtgattattgttacggaaagtgtttttagtatggac
ggcgatattgcggatcttcaacagttagttgcactcaaaaaacgttataccaatgtgcta
ctgtatgttgatgaagcccacgccataggtgtatacgggcagcaaggtttaggaatggca
gaagtcttcgactgtattcaagagattgactttttagtggggacttttggtaaggcattg
gcatctatgggggcttatcttgtttgtgatagcgagataagagaatacttaatcaatacg
atgcgtcctttaattttttctaccgcacttccaccgattaatgttgcttggacttacttt
ttatttgaacaattaccgcaatttactgaaaagcgtcatcatcttgagaaattaagccaa
atcttgcgaactgaagtgacgaaaagaagtgaatttccgctgctaagcgaaacttgcatc
gtgccatatatcttaggcgaaaatcagcaagcggtggaaaaagccgattatttgcaaaaa
caaggctactattgcttacctattcgtccaccaacagtgccaaaaggcacggctcgtctg
cgtttctcattaaccgcagatttaaccgaacaagatataatgggcttaattagctgtttg
taa

DBGET integrated database retrieval system